Recombinant Lipopolysaccharide export system permease protein lptF (lptF)

Shipped with Ice Packs
In Stock

Description

Functional Role in LPS Transport

LptF is indispensable for extracting LPS from the IM’s outer leaflet and transferring it to the periplasmic bridge. Key functional findings include:

  • ABC Transporter Activity: LptB₂FG uses ATP hydrolysis to power LPS extraction, with LptF and LptG forming the transmembrane cavity that accommodates LPS .

  • Suppressor Mutations: Single mutations (e.g., LptF R212G) bypass the essentiality of LptC, enabling a truncated transenvelope complex (LptFAD) to transport LPS .

  • Phenotypic Consequences: Depletion of LptF results in LPS accumulation at the IM, leading to defective OM biogenesis and cell lysis .

Evolutionary and Biological Significance

  • Conservation: The LptF/LptG dimer is conserved across Gram-negative bacteria, including Caulobacter crescentus and Thermatoga maritima, highlighting its essential role .

  • Evolutionary Link: The Lpt system predates the Lol lipoprotein transport pathway, suggesting ancestral roles in OM biogenesis .

Unresolved Questions and Future Directions

  • How do LptF’s periplasmic domains coordinate with LptA during LPS transfer?

  • Can LptF-specific inhibitors be designed without affecting human ABC transporters?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lptF; SF4228; S4489; Lipopolysaccharide export system permease protein LptF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Shigella flexneri
Target Names
lptF
Target Protein Sequence
MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF SRKGAV
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex LptBFG, which plays a crucial role in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane.
Database Links

KEGG: sfl:SF4228

Protein Families
LptF/LptG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of LptF in bacterial cells?

LptF functions as an essential component of the LPS transport machinery in Gram-negative bacteria. Along with LptG, it forms the transmembrane domain (TMD) of the ABC transporter that, in conjunction with the nucleotide-binding domain (NBD) LptB, releases lipopolysaccharide from the inner membrane . Genetic studies have confirmed that both lptF and lptG are essential genes in E. coli, as strains where these genes are depleted cease growth after approximately four generations and show evidence of cell lysis . The LptF protein participates in the critical process of extracting newly synthesized LPS molecules from the inner membrane and initiating their transport to the cell surface, a process fundamental to the biogenesis and maintenance of the outer membrane barrier in Gram-negative bacteria .

How is LptF structurally organized and what domains are critical for its function?

LptF is a multi-pass transmembrane protein with a complex topology. The protein contains transmembrane helices that anchor it in the inner membrane, with TM1 and TM5 being particularly important for forming the lateral gate with corresponding helices in LptG . Additionally, LptF contains a periplasmic β-jellyroll domain that is essential for its function in LPS transport . This periplasmic domain interacts with LPS molecules and likely coordinates with other Lpt pathway components. Structural studies using techniques such as DEER/PELDOR spectroscopy have revealed conformational dynamics between the transmembrane helices, particularly at the lateral gates formed between LptF-TM1 and LptG-TM5, which appear to undergo significant conformational changes during the LPS transport cycle .

What evidence confirms that LptF is essential for LPS transport to the cell surface?

Multiple lines of experimental evidence confirm LptF's essential role in LPS transport. Pulse-chase experiments utilizing the PagP-modification of LPS have demonstrated that when LptF is depleted, newly synthesized LPS fails to reach the cell surface . In these experiments, researchers exploit the fact that only LPS located at the cell surface can be modified by PagP. When LptF is depleted, LPS synthesized after depletion cannot be modified by PagP, indicating it does not reach the outer leaflet of the outer membrane . Additionally, genetic studies have shown that lptF deletion strains cannot be constructed unless a complementing copy of the gene is provided in trans, and growth ceases when expression of this complementing copy is turned off . These findings collectively establish that LptF is indispensable for the transport of LPS from its site of synthesis to the bacterial cell surface.

How do conformational changes in LptF contribute to the mechanism of LPS extraction and transport?

The conformational dynamics of LptF play a crucial role in the mechanism of LPS extraction and transport. DEER/PELDOR spectroscopy data reveals that LptF undergoes significant conformational changes during the transport cycle, particularly at the lateral gates formed with LptG . In the apo (unbound) state, these gates display considerable flexibility, while in the vanadate-trapped state (mimicking the ATP-bound state), the conformational distribution becomes somewhat narrower .

The lateral gate-1 between LptF-TM1 and LptG-TM5 appears to be particularly dynamic, showing a broad distance distribution in both detergent micelles and proteoliposomes . This enhanced dynamics at the lateral gate likely facilitates the interaction with LPS molecules and may be required for efficient extraction of LPS from the inner membrane. The structural data suggests that rather than adopting a single defined conformation, LptF explores a broad conformational space, with crystal structures capturing only some of these conformational states . This conformational heterogeneity appears to be functional, allowing the protein to accommodate the bulky LPS substrate and coordinate its movement through the transport pathway.

What interactions occur between the β-jellyroll domains of LptF and LptG during LPS transport?

The β-jellyroll domains of LptF and LptG form critical periplasmic components of the LptB2FG complex that interact with LPS during transport. PELDOR experiments examining distances between specific positions on these domains (F-S186R1 and G-V209R1) have revealed a major distance peak that agrees with simulations based on the LPS-bound structure . This suggests that these domains adopt a specific orientation relative to each other when engaged with LPS.

The β-jellyroll domains also exhibit significant internal dynamics, as evidenced by PELDOR measurements within each domain . These periplasmic domains likely coordinate the transfer of LPS molecules from the inner membrane extraction site to the LptC component of the transport pathway. The conformational flexibility observed in these domains may be essential for accommodating the variable chemical structure of LPS molecules and ensuring their efficient handover to downstream components of the transport pathway .

How do mutations in LptF affect the efficiency of LPS transport and bacterial viability?

Mutations that affect the lateral gates between LptF and LptG are particularly detrimental, as these regions appear to be critical for LPS extraction from the inner membrane . Similarly, mutations in the β-jellyroll domain can disrupt interactions with LPS and other Lpt components, compromising transport efficiency . The degree of functional impairment depends on the specific location and nature of the mutation, with some mutations causing severe growth defects and others having more subtle effects on LPS transport kinetics and membrane integrity.

What are the most effective methods for expressing and purifying recombinant LptF for structural and functional studies?

For expressing and purifying recombinant LptF, a methodological approach combining molecular biology techniques and membrane protein biochemistry is required:

  • Expression System Selection: For membrane proteins like LptF, specialized expression systems are necessary. E. coli C43(DE3) or Lemo21(DE3) strains are often effective for membrane protein expression as they can accommodate the metabolic burden of overexpressing membrane proteins.

  • Construct Design:

    • Add affinity tags (His6 or His10) to facilitate purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include TEV or 3C protease sites for tag removal

    • Optimize codon usage for expression host

  • Expression Optimization:

    • Test various induction conditions (temperature: 18-30°C)

    • Optimize inducer concentration (typically 0.1-0.5 mM IPTG)

    • Consider auto-induction media or continuous exchange cell-free systems for difficult constructs

  • Membrane Extraction and Solubilization:

    • Extract membranes through ultracentrifugation after cell disruption

    • Test multiple detergents for solubilization (n-Dodecyl-β-D-maltoside, n-Decyl-β-D-maltoside, or lauryl maltose neopentyl glycol have proven effective for many membrane transporters)

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for final polishing

    • Consider adding lipids during purification to maintain stability

This approach has been successfully employed for purifying LptF for structural studies using techniques such as ESR spectroscopy . The choice between detergent micelles and reconstitution into proteoliposomes depends on the specific experimental requirements.

What spectroscopic methods are most informative for studying LptF conformational dynamics?

Several spectroscopic methods have proven valuable for investigating the conformational dynamics of LptF:

  • DEER/PELDOR Spectroscopy: Double Electron-Electron Resonance (DEER), also known as Pulsed Electron-Electron Double Resonance (PELDOR), has been particularly informative for studying LptF dynamics . This technique requires site-directed spin labeling of strategically selected residues, typically using MTSL (1-oxyl-2,2,5,5-tetramethylpyrroline-3-methyl methanethiosulfonate) or similar spin labels. DEER/PELDOR provides distance measurements in the range of 1.5-8 nm, making it ideal for monitoring conformational changes within LptF or between LptF and other components of the LptB2FG complex .

  • Site-Directed Fluorescence Spectroscopy: Techniques such as Förster Resonance Energy Transfer (FRET) can complement DEER/PELDOR data by providing information about conformational dynamics in real-time and under various substrate conditions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of LptF that undergo conformational changes during the transport cycle by measuring changes in hydrogen-deuterium exchange rates.

  • Cryogenic Electron Microscopy (cryo-EM): While technically challenging for membrane proteins, cryo-EM can capture LptF in different conformational states within the context of the entire LptB2FGC complex.

For optimal results, these methods should be combined with functional assays to correlate structural changes with specific steps in the LPS transport process.

How can researchers effectively reconstitute the LptB2FG complex for functional studies in vitro?

Reconstituting the LptB2FG complex for functional studies requires careful consideration of lipid composition, protein:lipid ratios, and assay conditions:

  • Component Preparation:

    • Purify individual components (LptB, LptF, LptG) with compatible affinity tags

    • Consider co-expression and co-purification strategies for stable subcomplexes

    • Ensure high purity through multiple chromatography steps

  • Reconstitution Methods:

    • Detergent-mediated reconstitution: Mix purified components in appropriate detergent before controlled detergent removal

    • Direct incorporation: Add proteins during liposome formation

    • Lipid composition: E. coli polar lipid extract with additional phosphatidylglycerol can mimic native membrane environment

  • Functional Assay Development:

    • ATPase activity assays to monitor nucleotide hydrolysis by LptB

    • Fluorescently labeled LPS transport assays

    • Proteoliposome permeability assays

  • Validation Approaches:

    • Size distribution analysis (dynamic light scattering)

    • Freeze-fracture electron microscopy to confirm protein incorporation

    • Orientation analysis using protease accessibility

How should researchers interpret distance distribution data from DEER/PELDOR experiments on LptF?

Interpreting DEER/PELDOR data for membrane proteins like LptF requires careful consideration of several factors:

  • Distance Distribution Analysis:

    • Broader distributions often indicate conformational heterogeneity rather than experimental uncertainty

    • Multiple peaks suggest distinct conformational states

    • Compare experimental distributions with simulations based on available crystal structures

  • Comparative Analysis Framework:

    ConditionInterpretation of Broader DistributionInterpretation of Narrower Distribution
    Apo stateConformational flexibility/samplingRestricted conformational space
    Nucleotide-boundCatalytic intermediate statesStabilized conformational state
    Different environments (micelles vs. PLS)Environment-dependent conformational changesEnvironment-independent structural elements
  • Confidence Interval Assessment:

    • Evaluate 95% confidence intervals for each distance distribution

    • Peaks with larger uncertainty (as indicated in figure 3H with an asterisk in the search results) should be interpreted with caution

  • Software Selection:

    • DeerLab program for data in micelles

    • ComparitiveDeerAnalyzer for data in proteoliposomes

    • Different software may produce slightly different results, necessitating consistent analysis across datasets

For LptF specifically, DEER/PELDOR data has revealed significant conformational heterogeneity, particularly at the lateral gates formed with LptG . The broad distance distributions observed in both micelles and proteoliposomes suggest that LptF explores a range of conformations rather than adopting a single rigid structure. This flexibility likely reflects the functional requirements of the LPS transport process.

What strategies can researchers employ to resolve contradictions between structural data and functional outcomes when studying LptF?

Resolving contradictions between structural data and functional outcomes for LptF requires a multi-faceted approach:

  • Systematic Mutagenesis Strategy:

    • Design mutations based on structural information (e.g., lateral gate residues identified by DEER/PELDOR)

    • Create a spectrum of mutations (conservative to radical changes)

    • Assess both in vivo function (complementation assays) and in vitro properties

  • Correlation Analysis Framework:

    • Plot structural parameters against functional outputs

    • Identify outliers that contradict the general trend

    • Determine whether contradictions reflect alternative mechanisms or technical limitations

  • Integration of Multiple Structural Methods:

    • Compare results from different techniques (DEER/PELDOR, X-ray crystallography, cryo-EM)

    • Assess whether apparent contradictions reflect method-specific biases

    • Consider time scales of different methods relative to the transport cycle

  • Molecular Dynamics Simulations:

    • Use experimental structures as starting points

    • Simulate conformational changes under various conditions

    • Compare simulation outcomes with experimental measurements

How can researchers effectively combine data from different experimental approaches to build a comprehensive model of LptF function?

Building a comprehensive model of LptF function requires integration of diverse experimental data:

  • Data Integration Framework:

    Data TypeKey Information ProvidedIntegration Approach
    Genetic studiesEssentiality, in vivo functionDefine functional outcomes for structural states
    DEER/PELDORConformational distributionsMap conformational landscape
    Crystal structuresAtomic-level snapshotsProvide structural frameworks for interpreting dynamic data
    Biochemical assaysActivity measurementsCorrelate structure with function
    Molecular simulationsDynamic behaviorBridge gaps between experimental datasets
  • Sequential Knowledge Building:

    • Start with robust, experimentally validated components

    • Add layers of complexity as supported by data

    • Explicitly identify speculative connections

  • Contradictory Data Reconciliation:

    • Weight evidence based on methodological strengths/limitations

    • Consider whether contradictions reflect different experimental conditions

    • Develop alternative models that account for all observations

  • Visualization and Communication:

    • Create visual models showing LptF in multiple states

    • Develop animation sequences to illustrate proposed mechanisms

    • Clearly distinguish between directly observed and inferred states

This integrated approach has been productive in understanding LptF's role in the LptB2FG complex. For example, combining DEER/PELDOR data on conformational dynamics with genetic studies on essentiality has led to a model where LptF's conformational flexibility at lateral gates is functionally important for LPS extraction and transport. The model suggests that rather than operating through a rigid structural mechanism, LptF employs a dynamic conformational cycle coordinated with ATP hydrolysis by LptB to facilitate LPS movement.

What are the most promising approaches for targeting LptF in antimicrobial drug development?

As an essential component of the LPS transport machinery in Gram-negative bacteria, LptF represents a promising target for antimicrobial development. Several strategic approaches show particular promise:

  • Lateral Gate Inhibitors:

    • Design compounds that stabilize closed conformations of the lateral gates between LptF and LptG

    • Target the dynamic interface revealed by DEER/PELDOR studies

    • Focus on compounds that prevent the conformational changes necessary for LPS extraction

  • ATP Hydrolysis Uncouplers:

    • Develop molecules that disrupt the coupling between ATP hydrolysis by LptB and conformational changes in LptF

    • This approach would allow ATP consumption without productive LPS transport

  • Structure-Based Screening Strategy:

    • Virtual screening against multiple conformational states of LptF

    • Fragment-based approaches targeting specific binding pockets

    • Focus on regions with lower sequence conservation but high structural conservation

  • Combination Approaches:

    • Design inhibitors that simultaneously target LptF and other components of the Lpt pathway

    • Combine with outer membrane permeabilizers for synergistic effects

How might advanced imaging techniques further elucidate the dynamic behavior of LptF during the LPS transport cycle?

Advanced imaging techniques hold significant promise for deepening our understanding of LptF dynamics:

  • Single-Molecule FRET (smFRET):

    • Can track conformational changes in individual LptF molecules in real-time

    • Allows correlation of conformational changes with functional steps (ATP binding/hydrolysis, LPS binding/release)

    • Can reveal rare or transient conformational states missed by ensemble measurements

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Enables visualization of conformational changes in membrane proteins under near-native conditions

    • Can provide topographical information about LptF within the LptB2FG complex

    • Temporal resolution could capture intermediate states in the transport cycle

  • Cryo-Electron Tomography (cryo-ET):

    • Could visualize LptF in its native membrane environment

    • May capture different conformational states within the cellular context

    • When combined with subtomogram averaging, can provide structural information at near-molecular resolution

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines functional fluorescence imaging with structural electron microscopy

    • Could link LptF dynamics to specific cellular processes

    • May help understand LptF behavior in the context of bacterial envelope biogenesis

These techniques could address current knowledge gaps regarding how LptF's conformational dynamics are coordinated with other components of the LPS transport pathway and how these dynamics are regulated in response to cellular needs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.