Recombinant Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Recombinant LspA from Rickettsia typhi and E. coli has been cloned and expressed using plasmid vectors (e.g., pMW119 with a lac promoter) .

  • Expression systems: E. coli Top10 or BL21 strains .

  • Purification: Affinity chromatography via N-terminal 6xHis tags, followed by detergent solubilization (e.g., FC12 micelles) .

Functional Validation

Assay TypeObservationSource
Globomycin resistanceOverexpression of R. typhi lspA in E. coli increases resistance to globomycin, confirming functional SPase II activity .
Genetic complementationR. typhi lspA restores 20% growth in E. coli Y815 at 42°C, compared to 100% by E. coli lspA .

Substrate Specificity

  • Processes lipoproteins with a conserved lipobox motif (e.g., Leu-Ala-Ala-Cys) .

  • Cleaves 14 lipoproteins out of 89 secretory proteins predicted in R. typhi .

Antibiotic Development

  • Globomycin: Inhibits LspA by mimicking the prolipoprotein substrate, blocking the active site .

  • G5132: A globomycin analog effective against multidrug-resistant Acinetobacter baumannii by targeting LspA .

Kinetic Studies

  • Transcription dynamics: lspA expression peaks during host cell lysis (48–120 hours postinfection) in R. typhi .

  • Comparative activity:

ParameterR. typhi LspAE. coli LspA
Expression levelModerateHigh
Complementation efficiency20%100%
Globomycin IC₅₀Similar to E. coliBaseline

Conformational States and Substrate Binding

ConformationCharacteristicsRole
ClosedDominant in apo state; occludes active site Prevents nonspecific cleavage
OpenSubstrate-accessible; observed in MD simulations Facilitates substrate entry
IntermediateInduced by globomycin binding Inhibits enzymatic activity

Implications for Drug Discovery

  • Essentiality: LspA is critical for bacterial viability and virulence .

  • Resistance mitigation: Conserved active site residues reduce likelihood of resistance mutations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; VV1_0506; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Vibrio vulnificus (strain CMCP6)
Target Names
lspA
Target Protein Sequence
MSGKAQIFKQTGVRWLWLALVVFLADIGIKFIVMENMGYGWANRIEVLPFFNLLYVHNYG AAFSFLSDQAGWQRWLFTGIAFVVTGLLTYWMSKLPAAEKWNNVAYAMIIGGAIGNVFDR MVHGFVVDYLDFYWGTYHWPAFNLADTAICLGAAMIILDGFRKKEEEK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: vvu:VV1_0506

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA)?

Lipoprotein signal peptidase (lspA) encodes a Type II Signal Peptidase (SPase II), an essential component of lipoprotein processing in gram-negative bacteria. It functions by cleaving the signal peptide sequence between the amino acid at position -1 and the +1 cysteine, leaving the invariant cysteine residue as the new terminal amino acid in mature lipoproteins . The enzyme contains highly conserved residues and domains that are critical for its peptidase activity. LspA belongs to a novel class of aspartic peptidases that evolved exclusively in eubacteria, with two strictly conserved aspartic acid residues (forming a catalytic dyad) essential for its activity .

How does lspA function in the lipoprotein processing pathway?

LspA functions as part of a sequential processing pathway for bacterial lipoproteins. The pathway operates as follows:

  • Lipoproteins are synthesized with a specialized signal peptide containing a lipobox motif (consensus LxxC) in the carboxyl region of the signal peptide .

  • The lipobox targets the prolipoprotein to the correct posttranslational processing pathway .

  • First, prolipoprotein diacylglyceryl transferase (Lgt) covalently attaches a diacylglycerol molecule from phosphatidyl glycerol onto the sulfhydryl group of the invariant cysteine, creating a prolipoprotein .

  • Then, LspA (the Type II signal peptidase) cleaves the signal peptide between the amino acid at position -1 and +1, leaving the cysteine of the lipobox as the new amino-terminal residue of the mature lipoprotein .

Traditionally, lipidation by Lgt has been considered a prerequisite for LspA action, creating a dependency in the processing pathway .

How can recombinant lspA be cloned and expressed for functional studies?

Recombinant lspA can be cloned and expressed using the following methodology, based on successful approaches with Rickettsia typhi lspA :

  • Amplify the gene:

    • Use PCR to amplify the entire ORF of lspA from your organism of interest

    • Design primers with appropriate restriction sites (e.g., BamHI and EcoRI)

  • Cloning:

    • Clone the amplified fragment into an expression vector (e.g., pTrcHisA) that contains:

      • An N-terminal His6 tag for purification

      • A strong promoter (e.g., trc promoter)

    • Confirm the constructed plasmid by sequencing

  • Expression:

    • Transform the recombinant plasmid into an appropriate E. coli strain (e.g., E. coli Top10)

    • Induce protein expression according to the vector specifications

    • Detect the synthesis of recombinant SPase II proteins using:

      • Anti-HisG monoclonal antibody

      • Chemiluminescent immunodetection methods

  • Purification:

    • For membrane proteins like LspA, use detergent solubilization (e.g., fos choline-12)

    • Perform immobilized metal affinity chromatography using the His-tag

    • Remove imidazole using a desalting column and concentrate the protein

Researchers should note that lspA is a membrane protein with predicted four transmembrane-spanning regions , which can make expression and purification challenging.

What assays can be used to measure lspA enzymatic activity?

Several established methods can be used to assess lspA activity:

A. Gel-shift activity assay:

  • This coupled assay uses a recombinant prolipoprotein substrate (e.g., proICP)

  • The assay requires expression and purification of:

    • The prolipoprotein substrate

    • Lgt (the first enzyme in the pathway)

    • LspA (the enzyme being studied)

  • First, convert pre-proICP to proICP using Lgt in the presence of phospholipids

  • Then add purified LspA and monitor the cleavage reaction by gel electrophoresis

  • Cleavage of the signal peptide results in a detectable shift in protein migration

B. FRET assay:

  • Uses a single molecule FRET lipopeptide substrate

  • Allows real-time monitoring of peptidase activity

  • Provides quantitative kinetic parameters (Km and Vmax)

  • Example parameters from published research:

    • LspMrs (S. aureus): Km = 47 μM, Vmax = 2.5 nmol/(mg min) at 0.3 μM enzyme

    • LspPae (P. aeruginosa): Km = 10 μM, Vmax = 107 nmol/(mg min) at 0.1 μM enzyme

C. Globomycin resistance assay:

  • Based on the principle that overexpression of lspA confers increased resistance to globomycin

  • Measure bacterial growth in the presence of increasing concentrations of globomycin

  • Compare growth of cells harboring:

    • Empty vector (negative control)

    • Vector with recombinant lspA

  • Statistical significance of growth differences indicates functional activity

D. Genetic complementation assay:

  • Uses temperature-sensitive E. coli strains (e.g., E. coli Y815)

  • Transform with recombinant lspA and measure growth at the nonpermissive temperature

  • Restoration of growth indicates biological activity as SPase II

How can researchers generate and confirm lspA mutations?

Researchers can generate lspA mutations using the following methodologies:

  • Gene replacement method:

    • Utilize vectors containing positive-negative selection cassettes (e.g., pBJ113 with Km^r-galK)

    • Amplify upstream and downstream fragments of lspA

    • Clone these fragments into the vector at appropriate restriction sites

    • Electroporate into target bacteria

    • Select homologous recombinants based on antibiotic resistance

    • Counter-select for plasmid loss using galactose

    • This creates markerless in-frame deletions

  • Point mutations:

    • Use site-directed mutagenesis to target specific conserved residues

    • Mutations in the five conserved sequence regions can define residues important for activity

    • Key target residues include the catalytic aspartic acid residues essential for enzymatic activity

  • Confirmation of mutations:

    • Sequence verification

    • Phenotypic assays:

      • Globomycin resistance

      • Lipoprotein processing analysis

      • Growth characteristics under various conditions

What is the relationship between lspA expression and bacterial pathogenesis?

The relationship between lspA expression and bacterial pathogenesis has been studied using real-time quantitative reverse transcription-PCR (qRT-PCR) to monitor differential expression patterns. Key findings include:

  • Expression pattern during infection cycle:

    • Higher transcriptional levels of lspA at the preinfection time point indicates that only metabolically active bacteria are capable of infection and inducing host cell phagocytosis

    • Expression decreases until 8 hours post-infection

    • After bacterial doubling time, expression increases and peaks at 48 hours post-infection

    • Expression decreases at 120 hours post-infection when host cells begin to detach

  • Coordinated expression with other processing enzymes:

    • lspA and lgt (involved in lipoprotein secretion) show similar expression patterns

    • lepB (encoding SPase I for non-lipoprotein secretion) shows higher expression levels, suggesting it's the major signal peptidase for protein secretion

  • Lipoprotein processing and virulence:

    • Lipoprotein processing by SPase II is critical for intracellular growth and virulence in many bacteria

    • Processed lipoproteins may function as virulence factors or components of secretion systems

    • Inhibition of lspA by globomycin or similar compounds affects bacterial viability and virulence

This data suggests that lspA plays a significant role in bacterial pathogenesis by facilitating the processing of lipoproteins necessary for virulence, host interaction, and bacterial survival during infection.

What conformational dynamics does lspA undergo during catalysis?

The conformational dynamics of lspA during catalysis have been elucidated through hybrid experimental approaches combining molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) spectroscopy:

  • Identified conformational states:

    • Closed conformation

    • Intermediate conformation

    • Open conformation

  • Key structural features:

    • The extracellular loop (EL) from Asn53 to Lys63 (11 residues) shows significant flexibility

    • In different conformations, this loop can:

      • Form a half-turn helix with conserved Trp57 extending over the substrate

      • Completely unfold allowing Trp57 to contact the substrate from a different angle

  • Functional implications:

    • The open conformation is the only one that would allow prolipoprotein to enter and bind in the active site for signal peptide cleavage

    • LspA samples all three conformations in all states (apo, globomycin-bound, myxovirescin-bound), but the populations vary in each state

    • Loop flexibility appears crucial for substrate binding and may reflect necessary substrate promiscuity

  • Experimental validation:

    • Mutation of Gly54 (second residue in the loop) to proline (which limits mobility) fully inactivates the enzyme with lipoprotein substrate

    • DEER (Double Electron-Electron Resonance) data shows multiple distance populations in globomycin-bound LspA

This conformational flexibility explains how lspA can accommodate diverse lipoprotein substrates (e.g., 175 in P. aeruginosa, 67 in S. aureus) and how inhibitors like globomycin and myxovirescin exploit this flexibility through convergent evolution.

How does lspA inhibition affect bacterial physiology beyond lipoprotein processing?

The inhibition of lspA has broader effects on bacterial physiology beyond direct impairment of lipoprotein processing:

  • Effects on lipoteichoic acid (LTA) synthesis:

    • Mutation of lipoprotein processing pathway genes affects the expression or stability of LTA

    • lgt mutation dramatically increases susceptibility to Congo red (a selective LTA inhibitor)

    • lgt/lspA double mutants show even greater susceptibility than single lgt mutants

    • Multicopy expression of lspA increases susceptibility to LTA inhibitors

  • β-lactam resistance:

    • Mutation of the lspA gene significantly increases β-lactam resistance

    • This suggests a connection between lipoprotein processing and cell wall synthesis/integrity

  • Resistance mechanisms:

    • In response to lspA inhibitors (e.g., globomycin analog G5132), bacteria can develop resistance through:

      • Mutations in the signal peptide of specific lipoproteins

      • The identification of LirL (LspA inhibitor resistance lipoprotein) in Acinetobacter baumannii, a highly abundant lipoprotein primarily localized to the inner membrane

  • Membrane integrity:

    • Proper lipoprotein processing is necessary for maintaining membrane integrity

    • Disruption of this process affects multiple aspects of the bacterial cell envelope

These findings indicate that lspA plays a more complex role in bacterial physiology than previously thought, with connections to cell wall integrity, antibiotic resistance, and membrane composition.

What is the predicted substrate preference of lspA based on in silico analysis?

In silico analysis has provided insights into the substrate preference of lspA by predicting secretory proteins and potential lipoproteins:

  • Bioinformatic prediction tools:

    • SignalP (v3.0) - neural network and hidden Markov models

    • LipoP (v1.0)

  • Predicted distribution in Rickettsia typhi:

    • Out of 838 annotated ORFs, 89 secretory proteins were predicted to have signal peptide sequences

    • Of these 89 predicted secretory proteins, only 14 were recognized as putative lipoproteins

    • This relatively small proportion of lipoproteins (approximately 16% of secretory proteins) correlates with the higher transcriptional level of lepB compared to lgt and lspA

  • Recognition features:

    • Presence of a signal peptide with a lipobox motif (LxxC)

    • The invariant cysteine residue is the target for lipidation and subsequent processing

    • Specific sequence features around the cleavage site influence processing efficiency

  • Comparison across species:

    • The number of predicted lipoproteins varies significantly between bacterial species:

      • P. aeruginosa: 175 predicted lipoproteins

      • S. aureus: 67 predicted lipoproteins

This in silico prediction approach provides researchers with candidate lipoproteins for experimental validation and helps to understand the scope of lspA's role in different bacterial species.

How does globomycin inhibit lspA and what is its potential as an antimicrobial?

Globomycin is a cyclic peptide antibiotic that specifically inhibits lspA through the following mechanisms:

  • Binding mechanism:

    • Crystal structures reveal that globomycin binds to the active site of lspA

    • The extracellular loop (EL) containing a half-turn helix extends conserved Trp57 over the globomycin molecule, securing it against one side of the substrate-binding surface

    • This binding mechanism involves hydrogen bonding and mimics the natural substrate

  • Inhibition characteristics:

    • Globomycin exhibits tight binding inhibition with IC50 values approaching the enzyme concentration used for assay

    • Different orthologs show varying sensitivity to globomycin:

      • LspPae (P. aeruginosa): IC50 of 0.64 μM at 0.5 μM enzyme concentration

      • LspMrs (S. aureus): IC50 of 171 μM at 0.5 μM enzyme concentration

  • Antimicrobial potential:

    • Inhibition of lspA by globomycin prevents proper lipoprotein processing, affecting bacterial viability

    • Wild-type strains may show resistance due to poor penetration through the outer membrane

    • Modified globomycin analogs (e.g., G5132) show increased potency against wild-type and clinical isolates

  • Resistance mechanisms:

    • Overexpression of lspA confers increased globomycin resistance

    • Mutations in specific lipoprotein signal peptides can lead to resistance

    • In Acinetobacter baumannii, resistance to globomycin analogs has been mapped to a single hypothetical gene encoding an alanine-rich lipoprotein (lirL)

The development of globomycin analogs with improved penetration and potency represents a promising approach for targeting multidrug-resistant gram-negative bacteria, particularly in light of the essential nature of lipoprotein processing for bacterial viability.

What are the methods to assess inhibitor efficacy against recombinant lspA?

Several methodologies can be employed to assess inhibitor efficacy against recombinant lspA:

  • Enzyme inhibition assays:

    a. FRET-based assay:

    • Uses fluorescence resonance energy transfer substrates

    • Allows real-time monitoring of inhibition

    • Can determine IC50 values

    • Example results:

      • LspPae with globomycin: IC50 approaching enzyme concentration (0.1 μM)

      • LspMrs with globomycin: IC50 approaching enzyme concentration (0.3 μM)

    b. Gel-shift assay with prolipoprotein substrate:

    • Monitors inhibition of signal peptide cleavage from a prolipoprotein

    • Example results:

      • LspPae with globomycin using proICP: IC50 = 0.64 μM at 0.5 μM enzyme

      • LspMrs with globomycin using proICP: IC50 = 171 μM at 0.5 μM enzyme

  • Globomycin resistance assay:

    • Measures growth of E. coli expressing recombinant lspA in the presence of increasing globomycin concentrations

    • Comparative analysis:

      • Empty vector control: Growth rapidly decreases above 12.5 μg/ml globomycin

      • E. coli with recombinant lspA: Significant growth at 25-200 μg/ml globomycin

  • Structural studies:

    • X-ray crystallography to determine inhibitor binding mode

    • Molecular dynamics simulations to analyze conformational changes upon inhibitor binding

    • EPR spectroscopy to measure distances between spin-labeled residues in different functional states

  • In vivo efficacy:

    • Minimum inhibitory concentration (MIC) determination against various bacterial strains

    • Activity against clinical isolates, including multidrug-resistant strains

    • Assessment of membrane permeability effects on inhibitor efficacy

These complementary approaches provide a comprehensive evaluation of inhibitor potency, mechanism of action, and potential for development as antimicrobial agents.

How do lspA orthologs from different bacterial species compare functionally?

Lipoprotein signal peptidases from different bacterial species show interesting similarities and differences in their functional characteristics:

These comparative analyses highlight the evolutionary adaptations of lspA enzymes to species-specific requirements while maintaining core functional capabilities, which is important for understanding bacterial physiology and developing targeted antimicrobials.

What techniques can be used to study lspA in non-model organisms?

Studying lspA in non-model organisms presents unique challenges but can be approached using various techniques adapted from model organism research:

  • Genome mining and in silico analysis:

    • Identify putative lspA genes through homology searches using conserved domains

    • Use bioinformatic tools (SignalP, LipoP) to predict potential lipoprotein substrates

    • Analyze conserved residues and domains to assess potential functionality

  • Heterologous expression systems:

    • Clone putative lspA genes from non-model organisms into E. coli expression vectors

    • Express recombinant protein with affinity tags for purification

    • Functional validation through:

      • Globomycin resistance assays

      • Complementation of temperature-sensitive E. coli lspA mutants

  • Transcriptional analysis:

    • Extract RNA using cell type-specific protocols

    • Perform real-time quantitative RT-PCR to measure expression under different conditions

    • Compare expression patterns with other genes in the lipoprotein processing pathway (lgt, lepB)

  • Protein purification from native sources:

    • Use detergent solubilization (e.g., fos choline-12) for membrane protein extraction

    • Immobilized metal affinity chromatography if tagged constructs are used

    • Alternative purification strategies if native protein is targeted

  • Functional assays with available substrates:

    • Use synthetic peptide substrates for activity assays

    • Adapt FRET-based assays for kinetic measurements

    • Employ heterologous prolipoprotein substrates for gel-shift assays

  • Inhibitor studies:

    • Test sensitivity to known lspA inhibitors (globomycin, myxovirescin)

    • Determine minimum inhibitory concentrations (MICs)

    • Analyze resistance mechanisms if they develop

These approaches allow researchers to characterize lspA in diverse bacterial species, contributing to our understanding of lipoprotein processing across the bacterial domain and potentially identifying new antimicrobial targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.