Recombinant Liriodendron tulipifera Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPTKRNILVVGPVPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVN RIVRKEKGGYEITIADASDGHQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex; mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Liriodendron tulipifera?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Liriodendron tulipifera (Tulip poplar). This protein functions as an electron carrier, facilitating electron transfer between photosystem II and photosystem I during photosynthesis. In Liriodendron tulipifera, a significant hardwood species in North American eastern deciduous forests, this protein plays an essential role in energy conversion processes that support the tree's growth and development under varying environmental conditions . The mature protein spans amino acids 36-320 of the full sequence, with distinct functional domains that enable its electron transfer capabilities .

What expression systems are optimal for recombinant production of Liriodendron tulipifera Apocytochrome f?

While several expression systems can be employed for recombinant protein production, E. coli has been demonstrated as an effective host for Liriodendron tulipifera Apocytochrome f expression. The bacterial system offers several advantages:

Expression SystemAdvantagesLimitationsYield Potential
E. coli- Rapid growth
- High protein yields
- Cost-effective
- Well-established protocols
- Potential improper folding
- Lack of post-translational modifications
10-50 mg/L culture
Yeast systems- Eukaryotic processing
- Some post-translational modifications
- Longer cultivation time
- More complex media requirements
5-20 mg/L culture
Plant-based- Native-like modifications
- Proper folding
- Low yields
- Time-consuming
- Technical complexity
1-5 mg/L culture

For the recombinant Apocytochrome f described in the literature, an E. coli expression system with an N-terminal His-tag was employed, allowing for efficient purification while maintaining protein functionality . When designing expression constructs, researchers should consider:

  • Codon optimization for the host organism

  • Inclusion of appropriate fusion tags (His-tag being common and effective)

  • Selection of promoters that allow controlled induction

  • Growth conditions that maximize protein yield while minimizing inclusion body formation

What purification strategies yield the highest purity for Liriodendron tulipifera Apocytochrome f?

The purification protocol for His-tagged Liriodendron tulipifera Apocytochrome f typically involves a multi-step process:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices to exploit the His-tag affinity. This step typically achieves 70-80% purity.

  • Intermediate Purification: Ion exchange chromatography based on the protein's calculated pI to separate it from contaminants with different charge properties.

  • Polishing: Size exclusion chromatography to remove aggregates and achieve final purity typically exceeding 90% .

  • Quality Control: SDS-PAGE analysis to verify purity and Western blotting to confirm identity.

For applications requiring exceptional purity, researchers should consider implementing:

  • Gradient elution protocols during IMAC

  • Optimization of buffer conditions to minimize non-specific binding

  • Additional chromatographic steps based on hydrophobic interaction or other physicochemical properties

What are the optimal storage conditions for maintaining the activity of recombinant Apocytochrome f?

Long-term stability of Liriodendron tulipifera Apocytochrome f requires careful attention to storage conditions:

  • Primary storage: The lyophilized protein should be maintained at -20°C to -80°C upon receipt, with -80°C preferred for extended storage periods .

  • Working aliquots: For ongoing experiments, store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Buffer considerations: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

  • Avoid repeated freeze-thaw: Multiple freeze-thaw cycles significantly reduce protein activity. Creating single-use aliquots is strongly recommended .

How should researchers prepare and reconstitute lyophilized Apocytochrome f for experimental use?

The recommended reconstitution protocol involves:

  • Briefly centrifuge the vial before opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for samples requiring longer-term storage

  • Prepare multiple single-use aliquots to avoid repeated freeze-thaw cycles

  • Verify protein concentration using UV spectroscopy or Bradford assay prior to experimental use

What controls should be included when designing experiments with recombinant Apocytochrome f?

Robust experimental design for studies involving Liriodendron tulipifera Apocytochrome f should incorporate several types of controls:

  • Negative controls:

    • Buffer-only controls to establish baseline measurements

    • Inactive protein (heat-denatured Apocytochrome f) to distinguish specific from non-specific effects

    • Non-relevant protein with similar properties to confirm specificity

  • Positive controls:

    • Well-characterized homologous proteins from model species (e.g., Arabidopsis thaliana)

    • Previously validated functional assay standards

  • Technical controls:

    • Tag-only protein preparations to account for potential tag interference

    • Concentration gradient series to establish dose-dependent relationships

    • Time-course measurements to capture kinetic parameters

When studying electron transfer functions, researchers should include standard electron donors and acceptors with well-established redox potentials as reference points.

How can researchers account for potential tag interference in functional studies?

The N-terminal His-tag on recombinant Liriodendron tulipifera Apocytochrome f may potentially influence protein behavior in functional assays. To address this concern:

  • Comparative analysis: When possible, compare results with tag-free versions of the protein or with proteins containing alternative tag placements (C-terminal vs. N-terminal)

  • Tag removal: Consider incorporating a protease cleavage site between the tag and protein of interest, allowing tag removal after purification

  • Control experiments: Include parallel experiments with differently tagged versions of the same protein to identify any tag-specific effects

  • Structural considerations: Conduct in silico modeling to predict whether the tag position might interfere with functional domains or binding interfaces

  • Literature validation: Compare findings with published results on native (non-tagged) proteins to identify potential discrepancies

How can researchers investigate the electron transfer mechanisms of Apocytochrome f in vitro?

Investigating electron transfer mechanisms requires sophisticated biophysical approaches:

  • Spectroscopic techniques:

    • UV-Visible spectroscopy to monitor redox state changes

    • Electron Paramagnetic Resonance (EPR) spectroscopy to characterize redox centers

    • Time-resolved fluorescence to capture fast electron transfer events

  • Electrochemical methods:

    • Cyclic voltammetry to determine redox potentials

    • Protein film voltammetry to study electron transfer kinetics

    • Spectroelectrochemistry to combine spectroscopic and electrochemical measurements

  • Reconstitution systems:

    • Liposome reconstitution to mimic the native membrane environment

    • Minimal electron transfer chains with defined components

    • Solid-supported membrane systems for controlled orientation

  • Mutational analysis:

    • Site-directed mutagenesis of key residues to probe electron transfer pathways

    • Conservative vs. non-conservative substitutions to establish structure-function relationships

What approaches are effective for studying protein-protein interactions involving Apocytochrome f?

Protein-protein interactions involving Liriodendron tulipifera Apocytochrome f can be studied using:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Apocytochrome f or its interaction partners to pull down protein complexes

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics and affinity constants between Apocytochrome f and potential interaction partners

  • Isothermal Titration Calorimetry (ITC): Determining thermodynamic parameters of binding interactions

  • Förster Resonance Energy Transfer (FRET): Monitoring protein interactions in real-time by tagging potential partners with appropriate fluorophores

  • Cross-linking coupled with mass spectrometry: Identifying interaction surfaces through chemical cross-linking followed by proteomic analysis

  • Yeast two-hybrid screening: Identifying novel interaction partners from cDNA libraries

How does research on Liriodendron tulipifera proteins relate to its ecological adaptations?

Liriodendron tulipifera (tulip poplar) is an important component of the eastern deciduous forest in North America, and research on its proteins, including Apocytochrome f, provides insights into its ecological adaptations:

  • Climate response mechanisms: Studies of Liriodendron tulipifera have shown that its growth is strongly correlated with climate variables related to water balance, particularly precipitation during May through July of the growing season and during the previous year's growing season and autumn .

  • Temperature adaptations: The species shows negative correlation with prior year growing season maximum temperature but positive correlation with prior winter minimum temperature, suggesting complex temperature response mechanisms potentially mediated by proteins involved in photosynthesis .

  • Regional variation: The strength of correlations between growth and climate variables changes across the species' range, with water stress responses increasing from east to west as precipitation decreases . This suggests regional adaptations potentially reflected in protein structure or regulation.

  • Future climate implications: Research on key proteins like Apocytochrome f may help predict how the species will respond to climate change, as studies indicate tulip poplar growth will likely be adversely affected by increased drought frequency or severity, while potentially benefiting from increased winter temperatures in some parts of its range .

What insights about evolutionary biology can be gained from studying Liriodendron tulipifera Apocytochrome f?

Liriodendron tulipifera Apocytochrome f offers valuable evolutionary insights:

  • Phylogenetic analysis: Comparison of Apocytochrome f sequences across plant species allows reconstruction of evolutionary relationships and identification of conserved functional domains

  • Selection pressure: Analysis of non-synonymous to synonymous substitution ratios can reveal selection pressures acting on different regions of the protein

  • Functional conservation: Comparative studies of electron transfer efficiency across diverse plant species can highlight evolutionarily conserved mechanisms

  • Adaptation signatures: Identification of unique sequence features in Liriodendron tulipifera Apocytochrome f may reveal adaptations to its specific ecological niche

  • Molecular clock applications: The rate of sequence divergence in this conserved protein can be used to estimate divergence times between related species

What ethical considerations should researchers be aware of when working with recombinant proteins?

Researchers working with recombinant proteins like Liriodendron tulipifera Apocytochrome f should consider several ethical dimensions:

  • Biosafety protocols: Adhere to established biosafety guidelines for recombinant DNA technology and protein handling to prevent environmental contamination or laboratory accidents.

  • Alternatives to animal testing: Consider non-animal methods when designing experiments that traditionally might have used animal models. Organizations like PETA advocate for replacing animals in experiments with human-relevant methods .

  • Research reproducibility: Ensure detailed methodology reporting to enable other researchers to reproduce findings without duplicating unnecessary experiments, addressing the significant issue that up to 89% of preclinical studies cannot be reproduced .

  • Sustainable research practices: Implement waste minimization strategies and energy-efficient laboratory practices when working with recombinant proteins.

  • Transparency in research: Clearly communicate both the benefits and limitations of recombinant protein research to avoid overstating potential applications or breakthroughs.

What non-animal research methodologies can be effectively applied to photosynthetic protein studies?

In line with modern ethical research practices, several non-animal methodologies can be effectively applied to study photosynthetic proteins like Apocytochrome f:

  • In vitro reconstitution systems: Reconstructing minimal photosynthetic components in controlled environments to study electron transfer mechanisms.

  • Computational modeling: Using molecular dynamics simulations and quantum mechanics calculations to predict protein behavior and interactions.

  • Cell-free expression systems: Generating proteins in acellular environments that avoid both animal use and whole-organism manipulation.

  • Advanced imaging techniques: Employing cryo-electron microscopy and atomic force microscopy to visualize protein structures and interactions at near-atomic resolution.

  • Human cell-based assays: When studying conservation of electron transport mechanisms, human cell lines can sometimes be used instead of animal models, aligning with PETA's Research Modernization NOW approach that advocates for eliminating animal use in areas where they have shown to be poor surrogates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.