Recombinant Liriodendron tulipifera ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Liriodendron tulipifera ATP synthase subunit a, chloroplastic (atpI), is a genetically engineered protein derived from the chloroplast ATP synthase complex of the tulip tree (Liriodendron tulipifera). This subunit is a critical component of the F₀ sector of ATP synthase, a membrane-bound enzyme responsible for ATP synthesis during photosynthesis. The recombinant version, fused with an N-terminal histidine (His) tag, is produced in Escherichia coli for research applications .

ATP synthase in chloroplasts operates as a rotary motor, utilizing proton gradients to phosphorylate ADP into ATP. Subunit a (atpI) facilitates proton translocation across the thylakoid membrane, directly coupling proton movement with ATP synthesis .

Genomic and Evolutionary Context

The atpI gene is part of the chloroplast genome in Liriodendron tulipifera. Comparative analyses of chloroplast genomes in Magnoliaceae plants reveal that atpI is one of six ATP synthase-associated genes (atpA, atpB, atpE, atpF, atpH, atpI) conserved across angiosperms . Key findings include:

  • Genomic Location: The atpI gene resides in the large single-copy (LSC) region of the chloroplast genome .

  • Conservation: ATP synthase subunits exhibit high sequence similarity among Magnoliaceae species, reflecting their essential role in photosynthesis .

  • Phylogenetic Insights: Chloroplast genome comparisons place L. tulipifera in a clade distinct from Michelia and Woonyoungia species, highlighting evolutionary divergences in ATP synthase gene regulation .

Applications in Research

Recombinant atpI is primarily utilized for:

  • Enzyme Mechanism Studies: Investigating proton translocation and ATP synthesis kinetics in chloroplasts .

  • Structural Biology: Crystallization trials to resolve conformational changes during ATP synthesis .

  • Plant Biochemistry: Comparative studies of ATP synthase isoforms across plant species .

Limitations and Future Directions

While recombinant atpI enables mechanistic studies, challenges remain:

  • Protein Stability: Requires strict storage at -80°C to prevent aggregation .

  • Functional Validation: Further assays are needed to confirm in vivo activity post-purification.

Future research could explore:

  • CRISPR-Editing: Knockout studies to assess atpI’s role in chloroplast bioenergetics.

  • Proteomics: Interaction mapping with other ATP synthase subunits (e.g., atpB, atpH) .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your desired format in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
atpI
Target Protein Sequence
MNVLPCSINTLKGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSATIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPRKII QLPHGELAAPTNDINTTVALALPTSMAYFYAGFTKKGLSYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Liriodendron tulipifera and why is it significant for ATP synthase research?

Liriodendron tulipifera, commonly known as the Tulip Tree, is a species from the Magnoliaceae family that is extensively distributed throughout Eastern North America. It belongs to a relic genus comprising just two species: L. tulipifera and L. chinense, with the latter nearing endangerment due to low regeneration rates . The significance of L. tulipifera in ATP synthase research lies in its status as a relatively primitive flowering plant, which may provide evolutionary insights into chloroplast ATP synthase structure and function. Additionally, its widespread distribution and adaptability to various environments make it an interesting model for studying chloroplast energetics across different ecological conditions.

How does chloroplastic ATP synthase function in plant energy metabolism?

Chloroplastic ATP synthase (CF₀-CF₁-ATP synthase) functions as a critical enzyme complex that utilizes the proton gradient generated during photosynthesis to synthesize ATP. This multisubunit enzyme complex consists of two main parts: the membrane-embedded CF₀ sector (containing subunit a/atpI) and the catalytic CF₁ sector protruding into the stroma. The enzyme works through a rotary mechanism where proton movement through the CF₀ sector drives conformational changes in the catalytic sites of CF₁, leading to ATP synthesis .

The ATP synthase activity is tightly regulated by both light conditions and metabolic factors. In light, thioredoxin-mediated redox modulation activates the enzyme by reducing a disulfide bridge on the γ subunit, while in darkness, this bridge forms and inactivates the enzyme to prevent wasteful ATP hydrolysis . This dual regulation ensures efficient energy production during photosynthesis while conserving resources in the dark.

What structural features distinguish atpI from other ATP synthase subunits?

The atpI gene encodes subunit a of the CF₀ sector, which forms part of the proton channel through the thylakoid membrane. While specific structural information for L. tulipifera atpI is limited in the available research, studies on chloroplast ATP synthase from other plant species reveal that subunit a contains multiple transmembrane domains and plays a crucial role in proton translocation across the membrane.

Unlike the γ subunit that contains a chloroplast-specific regulatory loop with redox-active cysteine residues (Cys199 and Cys205 in Arabidopsis thaliana) , subunit a primarily functions in the mechanical aspects of proton movement rather than regulatory control. The subunit's structure is highly conserved across species due to its fundamental role in proton channeling, although species-specific variations may occur to optimize function in different environmental conditions.

What approaches are most effective for expressing recombinant L. tulipifera atpI?

For expressing recombinant L. tulipifera atpI, researchers should consider several expression systems, each with distinct advantages:

The choice of expression system should be guided by the specific research objectives, whether structural studies requiring high purity or functional assays demanding proper folding and assembly.

How can researchers assess conformational changes in atpI during ATP synthesis?

Investigating conformational changes in atpI during ATP synthesis requires sophisticated biophysical techniques:

  • Site-Directed Spin Labeling and EPR Spectroscopy: By introducing cysteine residues at strategic positions and labeling them with spin probes, researchers can monitor local conformational changes during function. This approach has been successfully employed with other ATP synthase subunits and could be adapted for atpI from L. tulipifera.

  • FRET Analysis: Introducing fluorescent pairs at key locations can reveal distance changes during catalysis. For membrane proteins like atpI, this requires careful selection of labeling sites that don't disrupt function.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: This technique can identify regions of atpI that undergo conformational changes by measuring differences in hydrogen-deuterium exchange rates under various functional states.

  • Cross-linking Studies: Chemical cross-linking combined with mass spectrometry can capture transient interaction states between atpI and neighboring subunits during the catalytic cycle.

Research on chloroplast ATP synthase has demonstrated that conformational changes in one subunit can affect distant parts of the complex. For example, studies have shown that modifications at the interface between alpha and beta subunits can affect nucleotide binding sites over 40Å away , suggesting complex allosteric networks that likely also involve the a subunit.

What is the relationship between atpI mutations and ATP synthase efficiency?

The relationship between atpI mutations and ATP synthase efficiency is complex and multifaceted:

Research methodologies for studying these effects typically involve site-directed mutagenesis followed by either in vitro reconstitution experiments or in vivo expression in model organisms where native ATP synthase components have been deleted or silenced.

What purification strategies yield the highest purity for recombinant atpI?

Purifying recombinant atpI presents significant challenges due to its hydrophobic nature as a membrane protein. The following strategies can be employed to maximize purity while preserving structural integrity:

  • Detergent Screening: A systematic evaluation of detergents is crucial for solubilizing atpI from membranes. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often provide a good balance between extraction efficiency and protein stability.

  • Affinity Chromatography: Engineering affinity tags (such as His₆, FLAG, or Strep-tag II) at either terminus of atpI facilitates initial capture. The optimal tag position should be determined empirically, as N-terminal tags may interfere with membrane insertion while C-terminal tags might affect function.

  • Size Exclusion Chromatography: This step separates properly folded protein from aggregates and removes detergent micelles. For atpI, a column matrix with an appropriate fractionation range for membrane proteins (typically 10-300 kDa) should be selected.

  • Ion Exchange Chromatography: Based on the theoretical isoelectric point (pI) of L. tulipifera atpI, ion exchange can provide additional purification. Separation conditions can be determined using computational tools like ExPASy to predict protein properties .

  • Density Gradient Centrifugation: For studies requiring native-like lipid environments, density gradient centrifugation of reconstituted proteoliposomes can separate empty liposomes from those containing atpI.

Through each purification step, it's essential to monitor protein quality using techniques like SDS-PAGE, Western blotting with specific antibodies (similar to approaches used for ATP synthase alpha subunit ), and functional assays to ensure the protein retains its native structure.

How can researchers effectively study interactions between atpI and other ATP synthase subunits?

Investigating the interactions between atpI and other ATP synthase subunits requires multiple complementary approaches:

These methods can reveal how atpI contributes to the structure and function of the ATP synthase complex, particularly how it participates in the conformational changes that couple proton movement to ATP synthesis across distances of over 40Å .

What are the challenges in optimizing expression systems for chloroplastic membrane proteins?

Expressing chloroplastic membrane proteins like atpI presents several challenges that researchers must address through careful optimization:

  • Codon Usage Optimization: Plant genes often contain codons that are rare in bacterial expression hosts. Synthesizing a codon-optimized version of L. tulipifera atpI gene can significantly improve expression levels in E. coli or other heterologous systems.

  • Toxicity Management: Overexpression of membrane proteins frequently toxifies host cells. Strategies to mitigate this include using tightly regulated inducible promoters, lower culture temperatures (16-20°C), and specialized E. coli strains designed for membrane protein expression.

  • Inclusion Body Recovery: When expressed in bacteria, atpI may form inclusion bodies. While traditionally viewed as problematic, inclusion bodies can be solubilized and refolded using optimized protocols involving chaotropic agents followed by careful detergent exchange.

  • Transit Peptide Considerations: Chloroplastic proteins contain transit peptides for organelle targeting. For recombinant expression, researchers must decide whether to include this sequence (which may improve folding) or exclude it (which may improve yield). Similar considerations would apply to the TPS genes studied in L. tulipifera, where subcellular localization affects protein function .

  • Expression Verification: Confirming successful expression can be challenging for membrane proteins. Western blotting using specific antibodies (similar to approaches used for ATP synthase alpha subunit ) or fusion to reporter tags (such as GFP) can help verify expression before attempting purification.

  • Lipid Environment Reconstitution: For functional studies, atpI may require reconstitution into liposomes with a lipid composition resembling the thylakoid membrane. Screening different lipid compositions is often necessary to optimize protein activity.

By systematically addressing these challenges, researchers can develop robust protocols for expressing and studying L. tulipifera atpI, contributing to our understanding of ATP synthase structure, function, and evolution.

How should researchers design experiments to study the regulation of atpI in different physiological conditions?

Designing experiments to study atpI regulation requires careful consideration of physiological relevance and technical feasibility:

Physiological ConditionExperimental ApproachKey MeasurementsControl Considerations
Light/Dark TransitionsGrowth chamber studies with controlled light cyclesATP synthase activity, proton gradient, thylakoid membrane potentialCompare with other ATP synthase subunits known to be redox-regulated (e.g., γ subunit)
Developmental StagesSampling across L. tulipifera leaf developmentatpI expression levels, protein abundance, ATP synthesis ratesNormalize against housekeeping genes and constitutive proteins
Stress Conditions (drought, temperature)Controlled stress application to L. tulipifera seedlingsMembrane integrity, ATP synthesis efficiency, proton leakInclude recovery phase after stress removal
Circadian Rhythm24-hour time-course sampling under constant conditionsTranscriptional regulation, post-translational modificationsConfirm circadian patterns with multiple 24-hour cycles

For each condition, researchers should employ both in vivo approaches (using intact plants or isolated chloroplasts) and in vitro reconstitution systems with purified components. Comparing results across these platforms can distinguish direct effects on atpI from indirect effects mediated through other cellular components.

What bioinformatic approaches are valuable for studying L. tulipifera atpI sequence conservation and evolution?

Bioinformatic analyses provide crucial insights into atpI evolution and conservation:

These analyses should be conducted with careful consideration of the unique evolutionary history of Liriodendron as a relic genus with only two extant species , providing valuable insights into the conservation of energy metabolism across plant evolution.

How might synthetic biology approaches enhance our understanding of atpI function?

Synthetic biology offers innovative avenues for exploring atpI function beyond traditional approaches:

  • Minimal ATP Synthase Design: Creating simplified versions of ATP synthase that retain only essential components can reveal the minimum structural requirements for function and the specific contribution of atpI.

  • Domain Swapping Experiments: Exchanging domains between atpI from L. tulipifera and other species can identify regions responsible for species-specific characteristics, similar to studies that introduced spinach chloroplast ATP synthase components into bacterial systems .

  • Orthogonal Translation Systems: Incorporating unnatural amino acids at specific positions in atpI using expanded genetic codes allows precise probing of structure-function relationships, particularly at proton-conducting residues.

  • De Novo Design: Computational design of alternative proton channels based on atpI structure could lead to novel energy-converting systems with tailored properties.

  • Optogenetic Control: Engineering light-sensitive domains into atpI could enable real-time control of ATP synthase activity, providing new tools for studying energy dynamics in chloroplasts.

These approaches extend beyond traditional mutagenesis studies and offer unprecedented control over protein structure and function, potentially revealing fundamental principles of biological energy conversion.

What are the implications of atpI research for understanding evolutionary adaptations in plant energy metabolism?

Research on L. tulipifera atpI has broader implications for understanding plant evolution and adaptation:

  • Evolutionary Rate Analysis: Comparing evolutionary rates of atpI with other ATP synthase subunits across plant lineages can reveal whether different components evolve under different constraints. This is particularly interesting in Liriodendron, which represents an ancient lineage of flowering plants.

  • Climate Adaptation Signatures: Comparing atpI sequences from L. tulipifera populations across diverse climatic regions may reveal adaptive variations that optimize ATP synthase function under different environmental conditions.

  • Horizontal Gene Transfer Assessment: Analyzing atpI sequences can help identify potential horizontal gene transfer events in plant evolution, particularly between chloroplasts and mitochondria or between endosymbionts and host plants.

  • Ancestral Sequence Reconstruction: Reconstructing ancestral atpI sequences provides insights into the evolutionary trajectory of ATP synthase and how its efficiency might have changed over evolutionary time.

  • Comparative Analysis with L. chinense: The endangered status of L. chinense creates urgency for comparative studies between the two Liriodendron species , potentially revealing how differences in energy metabolism might contribute to their different ecological performances.

Understanding these evolutionary patterns contributes not only to basic science but also potentially to conservation efforts for endangered species like L. chinense by identifying genetic factors contributing to their vulnerability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.