Recombinant Liriodendron tulipifera Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
cemA
Target Protein Sequence
MPKKKALTPLPYLASIVFLPWWISISFNKSLEPWVTNWWNTRQSETFLNDIQEKNVLERF IELEQLFLLDEMIKEYPGTQIQKLRIGIHKETIQLVKMHNEDHIHIILHFSTNIICFAIL SGYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVVYHSMNE
Uniprot No.

Target Background

Function
May be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the cemA gene in the L. tulipifera chloroplast genome?

The cemA gene in L. tulipifera is encoded in the chloroplast genome. Like most plant species, the L. tulipifera chloroplast genome has a quadripartite structure consisting of a large single copy (LSC) region, a small single copy (SSC) region, and two inverted repeat (IR) regions. The cemA gene is typically located in the LSC region of the chloroplast genome.

Comparative genomic analyses with other species in the Magnoliales order reveal that the chloroplast genome sequences are relatively conserved, with the IR regions showing higher conservation than the LSC and SSC regions . The gene order is generally maintained across related species, with cemA positioned in a conserved gene cluster.

When performing whole-genome alignment studies, researchers have observed that the IRs show the highest variation in gene structure among the aligned plastomes, but no rearrangement or inversion events have been detected in the cemA region .

What expression systems are most suitable for producing recombinant L. tulipifera cemA protein?

For recombinant expression of L. tulipifera cemA, several systems can be considered, each with advantages and limitations:

E. coli expression system:

  • Most commonly used due to rapid growth, high protein yields, and genetic tractability

  • For membrane proteins like cemA, specialized strains such as C41(DE3) or C43(DE3) are recommended

  • Expression vectors with controllable promoters (e.g., T7 or tac) allow modulation of expression levels

  • Cold-shock expression (16-20°C) often improves membrane protein solubility

  • Co-expression with chaperones may enhance proper folding

Yeast expression systems:

  • Pichia pastoris offers advantages for membrane proteins due to its eukaryotic membrane environment

  • Better equipped for post-translational modifications than bacterial systems

  • Can achieve high cell densities in bioreactor cultures

Insect cell/baculovirus expression system:

  • Closer to native eukaryotic environment

  • Superior for complex membrane proteins requiring specific lipid interactions

  • More costly and technically demanding than bacterial systems

Cell-free expression systems:

  • Allow direct incorporation into artificial membranes or detergent micelles

  • Eliminate toxicity issues associated with membrane protein overexpression

  • Enable rapid screening of conditions but typically yield lower amounts

Regardless of the chosen system, it's critical to include appropriate tags (His-tag, MBP, GST) to facilitate purification while minimizing interference with protein function. As noted in the product information for recombinant L. tulipifera cemA, "The tag type will be determined during production process," suggesting that tag optimization may be necessary on a case-by-case basis .

How can Design of Experiments (DoE) methodology be applied to optimize recombinant cemA expression?

Design of Experiments (DoE) provides a systematic approach to optimize recombinant protein expression while minimizing the number of experiments. For cemA expression, this methodology offers significant advantages over traditional one-factor-at-a-time approaches.

Step 1: Define critical factors and their ranges
Identify parameters likely to affect cemA expression:

  • Strain selection

  • Media composition

  • Temperature (typically 16-30°C)

  • Inducer concentration (e.g., IPTG 0.1-1.0 mM)

  • Induction optical density (typically OD₆₀₀ 0.4-1.0)

  • Expression duration (4-48 hours)

  • pH (6.5-8.0)

Step 2: Select appropriate DoE approach
Based on the number of factors:

  • Screening designs: Use Plackett-Burman design to identify significant factors from a larger set

  • Optimization designs: Apply Response Surface Methodology (RSM) like Central Composite Design (CCD) or Box-Behnken Design (BBD) to find optimal levels

Step 3: Experimental workflow example

Experiment StageDoE ApproachPurposeTypical FactorsTypical Experiments
Initial screeningPlackett-BurmanIdentify significant factors6-8 factors at 2 levels8-12 experiments
Factor optimizationBox-BehnkenFind optimal conditions3-4 factors at 3 levels15-27 experiments
ValidationConfirmation runsVerify predicted optimumOptimized parameters3-5 replicates

Step 4: Statistical analysis

  • Apply ANOVA to determine statistical significance of factors

  • Calculate F-ratios to prioritize factors (higher F-ratio indicates more significant impact)

  • Develop regression models to predict expression levels

  • Generate contour plots to visualize factor interactions

For membrane proteins like cemA, special considerations should include detergent types/concentrations and membrane targeting efficiency. As noted in search result , researchers using DoE for metabolic pathway optimization were able to boost production of target compounds from 9 to 48 mg/L, demonstrating the potential of this approach for optimizing challenging protein expression systems.

What purification strategies are effective for isolating recombinant cemA while maintaining its functional integrity?

Purifying recombinant cemA requires specialized approaches due to its membrane-embedded nature. A comprehensive purification strategy should include:

1. Membrane extraction and solubilization:

  • Cell disruption by sonication, French press, or enzymatic lysis

  • Membrane isolation via differential centrifugation (typically 100,000×g ultracentrifugation)

  • Solubilization using appropriate detergents:

    • Mild non-ionic detergents (n-dodecyl β-D-maltoside, LMNG, digitonin)

    • Detergent concentration optimization (typically 1-2% for extraction, 0.05-0.1% for purification)

    • Inclusion of stabilizing additives (glycerol, specific lipids, cholesteryl hemisuccinate)

2. Chromatographic purification:

  • Affinity chromatography using the engineered tag (e.g., IMAC for His-tagged cemA)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing and oligomeric state assessment

3. Quality assessment:

  • Purity analysis by SDS-PAGE and Western blotting

  • Structural integrity by circular dichroism or fluorescence spectroscopy

  • Thermal stability assays to optimize buffer conditions

  • Functional assays specific to cemA activity

4. Storage considerations:
Based on the product information for recombinant L. tulipifera cemA, optimal storage conditions include:

  • Buffer composition: "Tris-based buffer, 50% glycerol, optimized for this protein"

  • Temperature: "-20°C, for extended storage, conserve at -20°C or -80°C"

  • Handling: "Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week"

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to provide a lipid environment that mimics the native chloroplast membrane.

What analytical techniques are most effective for characterizing the structure and function of recombinant cemA?

Comprehensive characterization of recombinant cemA requires multiple complementary techniques:

Structural characterization:

Functional characterization:

  • Liposome reconstitution assays: Test transport function in membrane environment

  • pH-sensitive fluorescent probes: Monitor potential proton transport activity

  • CO₂ uptake assays: Measure potential carbon dioxide transport

  • Patch-clamp electrophysiology: If ion channel activity is suspected

Biophysical characterization:

  • Thermal shift assays: Assess protein stability under various conditions

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Determine oligomeric state

  • Differential scanning calorimetry: Measure thermal transitions and stability

  • Isothermal titration calorimetry: Quantify binding interactions with potential substrates

Computational analysis:

  • Transmembrane domain prediction: TMHMM, Phobius

  • Homology modeling: Based on related structures if available

  • Molecular dynamics simulations: Understand membrane interactions and dynamics

When analyzing membrane proteins like cemA, it's critical to consider the impact of the membrane environment or detergent micelle on the results and to validate findings using multiple orthogonal techniques.

How can comparative genomics inform our understanding of L. tulipifera cemA function?

Comparative genomics provides valuable insights into cemA function through evolutionary analysis across species:

1. Sequence conservation analysis:

  • Multiple sequence alignment of cemA proteins across plant species reveals:

    • Highly conserved residues likely essential for function

    • Variable regions that may confer species-specific adaptations

    • Patterns of selection pressure indicating functional constraints

2. Comparative chloroplast genomics:

  • Analysis of the Liriodendron tulipifera chloroplast genome in comparison with other species reveals:

    • Conservation of gene order and synteny around cemA

    • Conservation of the coding sequence across related taxa

    • Evolution of regulatory elements

3. Structural prediction and comparison:

  • Using bioinformatic tools to predict structural features across species:

    • Conservation of transmembrane domains

    • Identification of potential substrate binding sites

    • Structural motifs shared with proteins of known function

4. Co-evolution analysis:

  • Identification of proteins that show correlated evolutionary patterns:

    • Potential interaction partners

    • Proteins in the same functional pathway

    • Regulatory proteins that may control cemA activity

Recent comparative analyses of chloroplast genomes have provided valuable context for understanding cemA evolution. From studies of Myristicaceae species that used L. tulipifera as a reference, we know that "the PCGs [protein-coding genes] were highly conserved" across these related species . This high conservation suggests that cemA has an essential function that has been maintained throughout evolution.

Additionally, comparative analysis of SSRs (simple sequence repeats) across chloroplast genomes can provide insights into regulatory evolution. The chloroplast genomes studied contained "an average of 62 SSR loci" with specific distribution patterns that may affect gene expression .

How can recombinant cemA be used to investigate chloroplast membrane bioenergetics?

Recombinant cemA protein provides a valuable tool for investigating chloroplast membrane bioenergetics through several experimental approaches:

1. Reconstitution systems:

  • Proteoliposome reconstitution:

    • Incorporation of purified cemA into liposomes with defined lipid composition

    • Measurement of substrate transport or ion flux across membranes

    • Investigation of protein-lipid interactions essential for function

  • Nanodiscs or lipid nanodiscs:

    • Incorporation of cemA into nanoscale lipid bilayers

    • Stabilization of the protein in a native-like environment

    • Compatibility with various biophysical techniques

2. Proton transport studies:

  • pH-sensitive fluorescent probes:

    • Encapsulation of pH-sensitive dyes in proteoliposomes

    • Real-time monitoring of pH changes associated with cemA activity

    • Investigation of factors affecting proton flux rates

  • Patch-clamp electrophysiology:

    • Direct measurement of ion currents across membranes containing cemA

    • Characterization of conductance, selectivity, and gating mechanisms

    • Investigation of potential regulatory mechanisms

3. CO₂ transport assays:

  • Radiolabeled CO₂ uptake:

    • Measurement of 14C-labeled CO₂ transport into vesicles

    • Quantification of transport kinetics

    • Evaluation of inhibitors or activators

  • Mass spectrometry-based approaches:

    • Real-time monitoring of CO₂ consumption

    • Comparison of transport rates under various conditions

4. Interaction studies:

  • Co-immunoprecipitation with potential partner proteins

  • Crosslinking studies to identify interaction interfaces

  • Functional reconstitution with other chloroplast proteins

These approaches can provide mechanistic insights into cemA's role in chloroplast bioenergetics, potentially revealing its contribution to carbon fixation, pH regulation, or other essential chloroplast processes.

How do environmental stressors affect cemA expression and function in L. tulipifera?

Understanding how environmental stressors affect cemA expression and function requires integrating molecular, physiological, and ecological approaches:

1. Gene expression analysis:

  • Quantitative PCR to measure cemA transcript levels under stress conditions

  • RNA-seq to place cemA regulation in context of global gene expression changes

  • Promoter analysis to identify stress-responsive regulatory elements

2. Protein level responses:

  • Western blotting to quantify cemA protein abundance under stress

  • Post-translational modification analysis (phosphorylation, acetylation)

  • Protein turnover studies to determine stability under stress conditions

3. Functional changes:

  • Activity assays under stress conditions (temperature, pH, salt)

  • Structural stability assessments under stress

  • Localization studies to determine if stress affects membrane distribution

4. Climate response studies:
From LeBlanc et al.'s study on L. tulipifera climate responses, we can infer potential connections between environmental stressors and chloroplast function:

  • "Tulip poplar radial growth was correlated with variables associated with drought across almost all 45 sites included in this study"

  • "The indeterminate pattern of continued growth into the latter months of the growing season may cause this species to be more susceptible to late summer" stressors

Tulip poplar's sensitivity to drought suggests that chloroplast membrane proteins like cemA may play roles in stress responses. Researchers could investigate whether cemA expression or activity is altered in response to drought conditions, potentially mediating photosynthetic adjustments to water limitation.

5. Experimental approaches:

  • Controlled environment studies manipulating:

    • Temperature (heat/cold stress)

    • Water availability (drought/flooding)

    • Light intensity (high light/shade)

    • CO₂ concentration (elevated/limited)

  • Field studies across environmental gradients

  • Comparison with other species showing different stress tolerances

This research could reveal cemA's role in environmental adaptation and inform predictions about how L. tulipifera might respond to climate change.

What approaches can help resolve contradictory results in cemA protein expression experiments?

When facing contradictory results in cemA expression experiments, a systematic troubleshooting approach can help identify and resolve inconsistencies:

1. Systematic variation analysis:

  • Implement full factorial or fractional factorial designs to identify interaction effects

  • Use statistical tools (ANOVA, regression analysis) to quantify variability sources

  • Apply multivariate analysis to identify patterns in complex datasets

As noted in search result : "This multivariant method permits a thoroughly analysis compared to the traditional univariant method, where the response is evaluated changing one variable at a time while fixing the others. Furthermore, the multivariant method enables to characterize the experimental error, to compare the effects of variables between themselves when variables are normalized, and hence, to gather high-quality information with as few experiments as possible."

2. Variable isolation and control:

  • Plasmid sequence verification (confirm absence of mutations)

  • Expression strain authentication and passage number

  • Reagent lot-to-lot variation control

  • Equipment calibration and verification

3. Technical replication strategy:
When planning technical replicates, consider this structured approach:

Replication LevelPurposeMinimum NumberVariables to Control
TechnicalAssess measurement variability3Same sample, analysis conditions
BiologicalAssess biological variability3-5Different cultures, same conditions
ExperimentalAssess reproducibility2-3Different days, operators
Multi-laboratoryAssess robustness2+Different laboratories, equipment

4. Advanced analytics for contradiction resolution:

  • Meta-analysis techniques to combine data from multiple experiments

  • Bayesian statistical methods to incorporate prior information

  • Machine learning approaches to identify subtle patterns or batch effects

  • Principal component analysis to identify major sources of variation

5. Standardization implementation:

  • Establish standard operating procedures (SOPs) for all experimental steps

  • Use internal standards and reference materials

  • Implement quality control checkpoints throughout the workflow

  • Standardize reporting formats and metrics

By applying these approaches systematically, researchers can identify whether contradictory results stem from biological variability in cemA behavior, technical limitations in expression systems, or experimental artifacts that can be controlled.

How might CRISPR/Cas technologies be applied to study cemA function in L. tulipifera?

Despite the challenges of applying genetic modification techniques to trees like L. tulipifera, CRISPR/Cas technologies offer promising approaches for studying cemA function:

1. Chloroplast genome editing strategies:

  • Direct targeting of the cemA gene in the chloroplast genome

  • Introduction of point mutations to study structure-function relationships

  • Creation of tagged versions for localization studies

  • Development of conditional knockdown systems

2. Technical approaches for L. tulipifera transformation:

  • Protoplast transformation and regeneration

  • Agrobacterium-mediated transformation of embryogenic tissues

  • Biolistic delivery of CRISPR/Cas components to chloroplasts

  • In vitro multiplication of edited tissues

3. Alternative model systems:

  • CRISPR editing of cemA orthologs in model plants (Arabidopsis, tobacco)

  • Creation of transgenic plants expressing L. tulipifera cemA

  • Complementation studies in cemA mutants of model species

4. Functional genomics approaches:

  • RNA-guided transcript targeting to reduce cemA expression

  • CRISPR interference (CRISPRi) to repress cemA transcription

  • CRISPR activation (CRISPRa) to enhance cemA expression

  • Proteomics studies to identify interaction partners

5. Phenotypic analyses of edited plants:

  • Photosynthetic efficiency measurements

  • Carbon dioxide uptake and fixation rates

  • Growth response to environmental conditions

  • Chloroplast ultrastructure analysis

While these approaches present technical challenges, they offer promising avenues for understanding cemA function. The establishment of tissue culture systems for L. tulipifera, possibly building on work with Liriodendron hybrids where "adventitious rooting" techniques have been developed , could facilitate these genetic approaches.

What potential biotechnological applications might emerge from research on recombinant cemA protein?

Research on recombinant L. tulipifera cemA protein could lead to several biotechnological applications:

1. Enhanced photosynthetic efficiency:

  • Engineering improved CO₂ uptake in crop plants

  • Development of plants with greater carbon fixation capacity

  • Creation of stress-resistant photosynthetic systems

2. Bioreactor and carbon capture technologies:

  • Development of biomimetic membranes incorporating cemA

  • Creation of artificial photosynthetic systems for carbon capture

  • Engineering of microorganisms with enhanced CO₂ uptake capability

3. Biosensor applications:

  • Design of sensors for CO₂ detection and monitoring

  • Development of pH-responsive biosensing systems

  • Creation of stress indicators for environmental monitoring

4. Membrane protein research tools:

  • Use as a model system for membrane protein expression optimization

  • Development of standardized protocols for chloroplast membrane protein purification

  • Creation of expression tags or fusion systems optimized for chloroplast proteins

5. Synthetic biology applications:

  • Integration into artificial chloroplasts

  • Development of minimal photosynthetic systems

  • Creation of novel metabolic pathways leveraging CO₂ transport

These applications would build on the fundamental research currently being conducted on cemA and related chloroplast proteins, potentially contributing to solutions for climate change, agricultural productivity, and industrial biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.