Recombinant Liriodendron tulipifera Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Liriodendron tulipifera Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Liriodendron tulipifera Cytochrome b6-f complex subunit 4 (petD) refers to a specific protein subunit within the cytochrome b6-f complex, derived from the plant species Liriodendron tulipifera, commonly known as the tulip tree . This subunit is produced using recombinant DNA technology, implying that the gene encoding the petD subunit is expressed in a host organism (e.g., E. coli) to generate the protein in large quantities . The cytochrome b6-f complex is pivotal in photosynthetic electron transport in plants, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI) .

Role of Cytochrome b6-f Complex Subunit 4 (petD)

The cytochrome b6-f complex is a protein complex found in the thylakoid membranes of chloroplasts, essential for photosynthesis . It facilitates the transfer of electrons from plastoquinol to plastocyanin, contributing to the generation of a proton gradient that drives ATP synthesis. Subunit 4, encoded by the petD gene, is a component of this complex and plays a crucial role in its function and regulation .

Significance of Liriodendron tulipifera

Liriodendron tulipifera, the tulip tree, is often used in studies related to plant genetics and molecular biology, serving as a control in comparative analyses of chloroplast genomes . Studies have also identified various bio-functional constituents, including lignans, steroids, and benzenoids, with antioxidant and anti-melanogenic properties, from the stems of Liriodendron tulipifera .

Function of petD Subunit in State Transitions

Research indicates that the stromal region of cytochrome b6-f subunit IV is involved in state transitions, a process that regulates the antenna sizes of photosystems I and II . State transitions are mediated by reversible phosphorylation of light-harvesting complexes II, depending on the redox state of the plastoquinone pool. Specifically, residues Asn122, Tyr124, and Arg125 in the stromal loop linking helices F and G of subunit IV are crucial for these transitions. The Arg125 residue directly participates in the autophosphorylation of Stt7 kinase, which is activated by the cytochrome b6-f complex when the plastoquinone pool is reduced .

Recombinant Production and Applications

Recombinant petD protein is produced in host organisms like E. coli to facilitate in vitro studies and biochemical assays . The recombinant protein often includes a His-tag for purification purposes, allowing researchers to isolate and purify the protein for downstream applications .

Table 1: Properties of Recombinant Full Length Cytochrome b6-f Complex Subunit 4(Petd) Protein

PropertyDescription
Product OverviewRecombinant Full Length Cytochrome b6-f complex subunit 4(petD) Protein (Q4G3F7) (1-160aa), fused to N-terminal His tag, was expressed in E. coli.
SourceLiriodendron tulipifera
Host OrganismE. coli
TagN-terminal His tag
Sequence Length1-160 amino acids

Interaction with Stt7 Kinase

The cytochrome b6-f complex interacts with Stt7 kinase, a key regulator of state transitions . The stromal structure of the cytochrome b6-f complex directly interacts with Stt7, enhancing its autophosphorylation. This interaction is critical for adjusting the distribution of excitation energy between the two photosystems in response to changes in light quality and quantity .

Mutagenesis Studies

Random mutagenesis of the petD gene, followed by complementation assays, has been used to identify specific residues essential for state transitions . These studies involve screening for impaired state transitions in vivo using chlorophyll fluorescence imaging, providing insights into the structure-function relationships of the petD subunit .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
petD
Target Protein Sequence
MTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYISPVVILGTIACNVGLAVLEPSMI GEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKFQN PFRRPVATTVFLIGTVIALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, it facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.