Recombinant Liriodendron tulipifera Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System:

  • Produced in Escherichia coli with an N-terminal His-tag for affinity purification .

  • Available in quantities of 50 µg or custom batches .

Quality Control:

  • Validated via SDS-PAGE and Western blot .

  • Purity >90% confirmed by reverse-phase HPLC .

Functional Role in Photosynthesis

Cytochrome b6 is integral to the cytochrome b6f complex, which facilitates electron transfer between Photosystem II and I. Key functions include:

  • Electron Transport: Mediates proton-coupled electron transfer across thylakoid membranes .

  • Structural Stability: Interacts with Rieske iron-sulfur protein (PetC) and subunit IV (PetD) to maintain complex integrity .

Conservation Across Species:

SpeciespetB Length (bp)Genome Position
Liriodendron tulipifera215 aaChloroplast LSC
Tulipa patens222 aaChloroplast LSC
Nymphaea spp.221 aaChloroplast LSC

Data synthesized from plastid genome studies .

Research Applications

  • Enzyme-Linked Immunosorbent Assay (ELISA): Used as an antigen for antibody production and immunological studies .

  • Structural Biology: Facilitates crystallography studies of the cytochrome b6f complex .

  • Evolutionary Studies: Serves as a molecular marker for phylogenetic analyses in basal angiosperms .

Stability and Handling

  • Storage: Long-term storage at -80°C recommended; avoid repeated freeze-thaw cycles .

  • Activity Retention: Stable for one week at 4°C in working aliquots .

Discrepancies and Notes

  • UniProt ID Conflict: Source lists Q0G9I9, while cites P28058 (Spinach petB), suggesting potential annotation errors in commercial databases.

  • Sequence Variants: Discrepancies in terminal residues (1–215 vs. 1–222) may reflect differences in expression constructs or post-translational processing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare your order according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specification.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Liriodendron tulipifera and why is cytochrome b6 significant in this species?

Liriodendron tulipifera, commonly known as the tulip tree, is one of two species in the Liriodendron genus within the Magnoliaceae family. It is distinguished by its extensive natural distribution in Eastern North America, whereas its sister species L. chinense faces potential endangerment due to low regeneration rates .

Cytochrome b6, encoded by the petB gene, is a critical component of the photosynthetic electron transport chain located in chloroplasts. This protein is particularly significant in L. tulipifera because it functions within the context of a plant with specialized terpenoid biosynthesis pathways. Research indicates that chloroplast-associated processes, such as those involving cytochrome b6, may interact with terpenoid biosynthesis pathways that are uniquely regulated in L. tulipifera compared to L. chinense . Understanding the structure and function of cytochrome b6 can provide insights into adaptations that have allowed L. tulipifera to thrive across diverse ecological niches.

What expression systems are most suitable for recombinant Liriodendron tulipifera proteins?

The Escherichia coli BL21(DE3) strain coupled with pET vector systems remains the preferred expression system for recombinant proteins from L. tulipifera, including chloroplast proteins like cytochrome b6. This preference stems from the system's high expression capability and versatility .

When expressing L. tulipifera chloroplast proteins:

  • Signal peptide removal is crucial for obtaining soluble protein - research demonstrates that only signal peptide-detached recombinant proteins exist in soluble form .

  • Optimal induction parameters include:

    • Low IPTG concentrations (0.1-0.5 mM)

    • Reduced culture temperatures (16-20°C)

    • Extended induction periods (12-16 hours)

For chloroplast membrane proteins like cytochrome b6, additional considerations include the use of specialized detergents during purification and potential co-expression with chaperone proteins to enhance proper folding.

How should researchers approach cloning the petB gene from Liriodendron tulipifera?

Cloning the petB gene from L. tulipifera requires careful consideration of both genomic organization and expression strategy. Based on successful cloning approaches used for other L. tulipifera genes:

  • RNA extraction should target young, actively photosynthesizing leaves, where cytochrome b6 expression is highest.

  • RT-PCR with degenerate primers designed from conserved regions of the petB gene across related species offers a reliable approach.

  • Restriction site selection significantly impacts expression efficiency - sites closer to the ribosome binding site (rbs) demonstrate increased difficulty in expressing soluble recombinant proteins .

A recommended approach involves:

  • Using cDNA from L. tulipifera leaf tissue as template

  • Selecting restriction sites NdeI and XhoI for insertion into pET-28a vector

  • Removing signal peptide coding regions to ensure soluble expression

What are the optimal conditions for soluble expression of recombinant Liriodendron chloroplast proteins?

Several key factors significantly influence the soluble expression of recombinant L. tulipifera chloroplast proteins:

  • Temperature regulation: Low-temperature induction (16-20°C) has demonstrated significant benefits for soluble protein expression compared to standard 37°C conditions . This slower induction allows proper protein folding, particularly important for complex chloroplast proteins.

  • Signal peptide considerations: Only signal peptide-detached recombinant proteins can exist in soluble form. When expressing chloroplast proteins like cytochrome b6, removing the transit peptide sequence is essential .

  • Restriction site selection: The proximity of the selected restriction site to the ribosome binding site impacts expression efficiency. Sites closer to the rbs make soluble protein expression more challenging .

  • Optimal induction parameters:

    • IPTG concentration: 0.2-0.5 mM

    • Culture OD600: 0.6-0.8

    • Induction duration: 16-18 hours

These parameters must be empirically optimized for each specific construct, as variations in protein structure may require adjustments to the standard protocol.

How does His-tag positioning affect purification efficiency of recombinant cytochrome b6?

The position of the 6×His-tag significantly impacts both expression and purification of recombinant chloroplast proteins from L. tulipifera. Research indicates:

  • C-terminal His-tag fusion proteins demonstrate higher affinity to Ni²⁺ columns than N-terminal fusions . This is particularly relevant for membrane proteins like cytochrome b6, where N-terminal tags may interfere with proper membrane insertion.

  • Protein length considerations: Shorter recombinant proteins show enhanced affinity to Ni²⁺ columns . For cytochrome b6, constructing minimal functional domains may improve purification efficiency.

  • Comparing common fusion tag positions:

Fusion PositionAdvantagesDisadvantages
C-terminal His-tagHigher column affinity; Less interference with folding; Better functional preservationPotential accessibility issues if C-terminus is buried
N-terminal His-tagEasy accessibility for purification; Can be cleaved to produce native N-terminusMay interfere with protein folding or function; Lower column affinity
Internal His-tagCan preserve both termini in native stateComplex design; May disrupt protein structure

The optimal tag position should be determined experimentally, but evidence suggests C-terminal tagging offers superior results for most chloroplast proteins .

How can structural analysis of recombinant cytochrome b6 provide insights into photosynthetic efficiency in Liriodendron tulipifera?

Structural characterization of recombinant cytochrome b6 can reveal species-specific adaptations that influence photosynthetic efficiency in L. tulipifera:

  • Comparative structural studies: Analyzing differences between cytochrome b6 from L. tulipifera and L. chinense may reveal adaptations linked to their differential ecological distributions. Similar to the interspecific variations observed in terpenoid biosynthesis genes like TPS32 , variations in photosynthetic proteins could contribute to differing environmental adaptations.

  • Structure-function relationships: Using site-directed mutagenesis on recombinant cytochrome b6 allows:

    • Identification of critical residues for electron transport

    • Mapping of interaction sites with other photosynthetic complex components

    • Understanding how structural elements contribute to stability under varying environmental conditions

  • Integration with chloroplast metabolic networks: As demonstrated with the LtuTPS32 gene, chloroplast-associated processes participate in specialized metabolic pathways . Cytochrome b6 structural features may reveal connections between primary photosynthetic functions and specialized metabolite production in L. tulipifera.

What methodological approaches best address protein misfolding issues specific to Liriodendron chloroplast proteins?

Membrane proteins like cytochrome b6 present significant folding challenges when expressed recombinantly. Based on successful approaches with other challenging proteins, researchers should consider:

  • Co-expression with molecular chaperones: The addition of chaperone plasmids encoding GroEL/GroES, DnaK/DnaJ/GrpE, or specific chloroplast chaperones can significantly improve folding efficiency.

  • Temperature optimization: Low-temperature induction (16°C) has proven beneficial for soluble expression of complex proteins . For cytochrome b6, extending induction times at reduced temperatures allows proper incorporation of cofactors.

  • Solubilization strategies:

    • Mild detergents (DDM, LMNG) for membrane protein extraction

    • Lipid supplementation during purification

    • Nanodiscs or amphipols for stabilization of purified protein

  • Protein engineering approaches:

    • Fusion to solubility-enhancing partners (MBP, SUMO)

    • Strategic distribution of charged residues on protein surface

    • Design of minimal functional constructs

These methodologies should be systematically evaluated and optimized for each specific construct.

What strategies can resolve expression issues when working with recombinant Liriodendron tulipifera cytochrome b6?

When encountering expression difficulties with recombinant cytochrome b6 from L. tulipifera, researchers should systematically evaluate:

  • Codon optimization: L. tulipifera chloroplast genes may contain rare codons that limit expression in E. coli. Using codon-optimized synthetic genes or co-expressing rare tRNA plasmids (e.g., Rosetta strains) can address this issue.

  • Expression construct design:

    • Verify complete removal of transit peptide sequences

    • Ensure adequate spacing between restriction sites and coding sequence

    • Consider the impact of restriction site selection on expression

    • Evaluate alternative vector systems if pET vectors yield poor results

  • Host strain selection: While BL21(DE3) is standard, specialized strains offer advantages:

    • C41(DE3) and C43(DE3) for membrane proteins

    • Arctic Express for enhanced cold-temperature expression

    • SHuffle for disulfide-bonded proteins

  • Induction parameters:

    • Reduce IPTG concentration to minimize toxicity

    • Optimize cell density at induction

    • Extend expression time at lower temperatures

How can researchers verify the functional integrity of recombinant cytochrome b6?

Confirming the functional integrity of recombinant cytochrome b6 from L. tulipifera requires multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible absorption spectroscopy to verify correct heme incorporation (characteristic peaks at ~560 nm and ~530 nm)

    • Circular dichroism to assess secondary structure integrity

    • Fluorescence spectroscopy to evaluate tertiary structure

  • Redox activity assays:

    • Electron transfer capacity measurement using artificial electron donors/acceptors

    • Cytochrome oxidation/reduction kinetics compared to native protein

  • Protein-protein interaction studies:

    • Pull-down assays with known interaction partners

    • Surface plasmon resonance to quantify binding affinities

    • Reconstitution with other components of the cytochrome b6f complex

  • Thermal stability analysis:

    • Differential scanning calorimetry to assess structural stability

    • Thermal shift assays to monitor unfolding transitions

Each method provides unique information about protein integrity, and concordance between multiple approaches provides the strongest evidence for functional preservation.

How might recombinant cytochrome b6 research contribute to understanding evolutionary adaptations in Liriodendron species?

Comparative studies of recombinant cytochrome b6 from L. tulipifera and L. chinense could reveal important evolutionary insights:

  • Adaptation mechanisms: Similar to how the TPS gene family shows differential expression between the two Liriodendron species , cytochrome b6 variants may reflect adaptations to different ecological niches. These adaptations could explain why L. tulipifera has thrived across Eastern North America while L. chinense faces endangerment.

  • Interspecific hybridization potential: Understanding fundamental differences in chloroplast proteins like cytochrome b6 between the two species could inform conservation strategies for the endangered L. chinense through interspecific hybridization approaches.

  • Evolutionary pressure analysis: The identification of conserved versus variable regions in cytochrome b6 between the species offers insights into which protein domains face selective pressure, potentially linking photosynthetic efficiency to ecological fitness.

  • Integration with wider -omics approaches: Combining recombinant protein studies with genomic, transcriptomic, and metabolomic analysis can provide a comprehensive picture of how evolutionary forces have shaped Liriodendron species differently through their photosynthetic apparatus.

What emerging technologies show promise for studying protein-protein interactions involving cytochrome b6 in Liriodendron tulipifera?

Several cutting-edge methodologies offer new avenues for investigating cytochrome b6 interactions:

  • Cryo-electron microscopy: Recent advances allow visualization of membrane protein complexes in near-native environments, enabling detailed structural analysis of cytochrome b6 within the context of larger photosynthetic assemblies.

  • Proximity labeling approaches:

    • APEX2 fusion for in vivo biotinylation of interaction partners

    • BioID identification of transient and stable interactions

    • These methods could identify novel interaction partners specific to L. tulipifera cytochrome b6.

  • Native mass spectrometry: Emerging techniques preserve protein complexes during ionization, allowing direct measurement of intact membrane protein assemblies with associated lipids and cofactors.

  • Single-molecule FRET: For studying dynamic conformational changes during electron transport, providing insights into species-specific functional adaptations.

  • Computational approaches:

    • Molecular dynamics simulations of species-specific variants

    • Machine learning-based prediction of interaction networks

    • Phylogenetic analysis of sequence variations across Magnoliaceae

These emerging technologies, when applied to recombinant L. tulipifera cytochrome b6, could reveal unprecedented insights into the structure, function, and evolution of photosynthetic systems in this ancient genus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.