Recombinant Liriodendron tulipifera NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFSRSESLKEVYGLVWLLVPIFTPVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIRLFSIGPSIAVISILLSYSVIPFGY RLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVL SISLLSNSSSTVDIVEAQSKYGFGGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKSGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFIPELFGINKTGGV FGTTIGIFITLAKAYLFLFIPITTRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What distinguishes NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) from other NDH complex subunits in Liriodendron tulipifera?

NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) is a core component of the chloroplastic NDH complex in Liriodendron tulipifera, functioning distinctly from other subunits like ndhE (subunit 4L). While both are integral to electron transport, ndhA typically forms part of the membrane domain of the complex, containing multiple transmembrane helices essential for proton translocation. Unlike ndhE, which is generally smaller and serves auxiliary functions, ndhA plays a central role in the assembly and structural integrity of the entire NDH complex . The ndhA gene has been preserved in L. tulipifera's remarkably conserved genome, which exhibits an extraordinarily low silent substitution rate compared to other angiosperms .

How does the chloroplastic NDH complex in Liriodendron tulipifera contribute to plant resilience?

The chloroplastic NDH complex in Liriodendron tulipifera plays a crucial role in cyclic electron flow around photosystem I, enabling the plant to adapt to various environmental stressors. L. tulipifera, which can grow to significant heights in its natural environment with a long straight stem reaching upwards of 50 feet, depends on efficient photosynthetic mechanisms for energy production under variable light conditions . The NDH complex, including the ndhA subunit, facilitates ATP synthesis without concurrent NADPH production, allowing for flexible energy balance during environmental fluctuations. Research indicates that this mechanism enables L. tulipifera to withstand temperature variations and light stress, contributing to its longevity and successful establishment across diverse ecological niches in eastern North America .

What evolutionary insights can be gained from studying ndhA in Liriodendron tulipifera?

Studying ndhA in Liriodendron tulipifera offers valuable evolutionary insights due to the species' position as a basal angiosperm. L. tulipifera belongs to the Magnoliaceae family and represents one of the earliest diverging lineages of flowering plants. Its mitochondrial genome has evolved remarkably slowly in virtually all respects, with an extraordinarily low genome-wide silent substitution rate and conservation of ancestral gene clusters . This evolutionary conservation likely extends to its chloroplast genome as well.

Comparative analyses of ndhA across different plant lineages, using L. tulipifera as a reference point, can illuminate the evolutionary trajectory of photosynthetic machinery in angiosperms. The retention of genes frequently lost in other angiosperm lineages makes L. tulipifera particularly valuable for reconstructing ancestral states of plant organellar genomes . This evolutionary perspective helps researchers understand the selective pressures that have shaped chloroplast electron transport components across diverse plant species.

What are the optimal expression systems for producing recombinant Liriodendron tulipifera ndhA protein?

Based on research with related proteins, several expression systems have demonstrated efficiency for producing recombinant chloroplastic proteins from Liriodendron tulipifera. The optimal system depends on research objectives, required protein modifications, and downstream applications:

Expression SystemAdvantagesLimitationsOptimal For
E. coliHigh yield, rapid growth, cost-effective, established protocolsLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production, protein-protein interaction assays
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher-order folding capabilities, scalableLower yields than bacteria, longer expression timeFunctional studies requiring proper folding and limited post-translational modifications
Baculovirus/Insect cellsComplex eukaryotic processing, suitable for membrane proteinsTechnical complexity, higher cost, moderate yieldsFunctional studies of membrane-integrated ndhA, conformational analyses
Mammalian cellsMost sophisticated folding and processing machineryHighest cost, lowest yields, complex protocolsStudies requiring mammalian-type glycosylation or specific modifications

When expressing recombinant ndhA, incorporating a purification tag (His-tag or GST) at either the N or C-terminus typically facilitates downstream purification. For optimal expression in E. coli, codon optimization is recommended based on the significant codon usage bias between L. tulipifera and bacterial systems .

What chloroplast transformation strategies can be applied for studying ndhA function in Liriodendron tulipifera?

Chloroplast transformation represents a powerful approach for studying ndhA function in Liriodendron tulipifera. Drawing from successful plastid transformation methodologies in other species, researchers can adapt the following strategies:

  • Vector Design: Construct a species-specific chloroplast expression vector containing:

    • Homologous recombination regions flanking the insertion site (e.g., regions analogous to the 16S-trnI and trnA-23S used in Chlorella vulgaris)

    • Plastid-specific promoters (such as Prrn) to drive expression

    • Selectable marker gene (typically antibiotic resistance)

    • The ndhA gene with appropriate regulatory elements

  • Transformation Protocol:

    • Electroporation using carbohydrate-based buffers has shown success in chloroplast transformation of other species

    • Particle bombardment represents an alternative approach for woody species like L. tulipifera

    • Protoplast isolation from young leaves followed by PEG-mediated transformation

  • Selection and Regeneration:

    • Selection on media containing appropriate antibiotics (e.g., kanamycin or spectinomycin)

    • Confirmation of homoplasmy through multiple selection rounds

    • Regeneration protocols specific to L. tulipifera tissue culture requirements

  • Verification Methods:

    • PCR analysis to confirm integration

    • Western blotting to verify protein expression

    • Functional assays to assess NDH complex activity

This methodology enables both knockout studies to understand ndhA function and the introduction of modified versions to investigate structure-function relationships .

How can researchers effectively isolate and purify active ndhA protein from recombinant sources?

Isolating and purifying active ndhA protein from recombinant sources requires specialized protocols to maintain structural integrity and function of this membrane-associated protein:

  • Cell Lysis and Membrane Fraction Isolation:

    • For bacterial expression systems, use gentle lysis methods (e.g., enzymatic lysis with lysozyme followed by mild sonication)

    • Isolate membrane fractions through differential centrifugation (10,000 × g to remove debris, followed by 100,000 × g to collect membranes)

    • Resuspend membrane fractions in stabilizing buffer containing glycerol (>10%) to maintain protein integrity

  • Detergent Solubilization:

    • Screen multiple detergents (DDM, LDAO, Triton X-100) at various concentrations (0.5-2%) for optimal solubilization

    • Perform solubilization at 4°C for 1-2 hours with gentle agitation

    • Remove insoluble material by centrifugation (100,000 × g for 1 hour)

  • Affinity Purification:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Include detergent at concentrations above CMC in all purification buffers

    • Elute with imidazole gradient (50-500 mM) to minimize co-purification of contaminants

  • Quality Assessment:

    • Verify purity (>90% as achieved with other recombinant L. tulipifera proteins)

    • Assess protein stability through thermal shift assays

    • Confirm native conformation through circular dichroism spectroscopy

  • Storage Considerations:

    • Store purified protein in buffer containing 10-20% glycerol

    • Maintain at -20°C for short-term storage or -80°C for long-term stability

    • Avoid repeated freeze-thaw cycles as they significantly reduce activity

How can researchers investigate protein-protein interactions within the NDH complex involving ndhA?

Investigating protein-protein interactions within the NDH complex involving ndhA requires specialized approaches to address the challenges of membrane protein complexes:

  • Co-immunoprecipitation (Co-IP):

    • Generate specific antibodies against ndhA or use epitope-tagged versions

    • Solubilize thylakoid membranes using mild detergents (digitonin or DDM)

    • Precipitate ndhA and identify interaction partners using mass spectrometry

    • Validate interactions through reciprocal Co-IP experiments

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments (e.g., YFP) fused to ndhA and potential interacting partners

    • Transform chloroplasts with constructs expressing fusion proteins

    • Visualize interactions through fluorescence microscopy

    • Quantify interaction strength through fluorescence intensity measurements

  • Chemical Cross-linking Coupled with Mass Spectrometry:

    • Treat isolated thylakoid membranes with membrane-permeable cross-linkers

    • Digest cross-linked complexes and analyze by LC-MS/MS

    • Identify cross-linked peptides to map interaction interfaces

    • Create 3D structural models based on cross-linking constraints

  • Blue Native PAGE Analysis:

    • Separate native protein complexes using non-denaturing electrophoresis

    • Identify subcomplexes containing ndhA through immunoblotting

    • Perform second-dimension separation to resolve individual components

    • Compare complex assembly in wild-type and mutant backgrounds

These complementary approaches provide comprehensive insights into ndhA's interaction network within the NDH complex and its role in complex assembly and function .

What analytical approaches can resolve conflicting data on ndhA function in photosynthetic electron transport?

Resolving conflicting data on ndhA function in photosynthetic electron transport requires multifaceted analytical approaches:

  • Standardized Physiological Measurements:

    • Implement consistent growth conditions across experiments (light intensity, temperature, humidity)

    • Standardize leaf developmental stages for measurements

    • Utilize multiple technical and biological replicates

    • Apply statistical methods to determine significant differences (ANOVA with appropriate post-hoc tests)

  • Complementary Biophysical Techniques:

    • Chlorophyll fluorescence analysis (PAM fluorometry)

    • P700 absorbance measurements for PSI activity

    • Electrochromic shift (ECS) measurements for proton motive force

    • Thylakoid membrane potential measurements

  • Genetic Complementation Studies:

    • Generate ndhA knockout lines

    • Create complementation lines with wild-type and mutant versions

    • Test functional restoration under various environmental conditions

    • Quantify NDH complex assembly in different genetic backgrounds

  • Specialized Electron Transport Measurements:

    • Use artificial electron donors/acceptors to isolate specific pathways

    • Measure NAD(P)H oxidation rates in isolated thylakoids

    • Determine electron transport rates through specific complexes

    • Conduct measurements under various light, temperature, and CO₂ conditions

  • Meta-analysis Approach:

    • Systematically review published literature on ndhA function

    • Identify methodological differences that may explain conflicting results

    • Conduct statistical analysis of pooled data when appropriate

    • Develop a consensus model integrating diverse findings

This comprehensive analytical framework helps reconcile contradictory findings by identifying context-dependent functions of ndhA and methodological factors that influence experimental outcomes .

How can CRISPR-Cas9 technologies advance the study of ndhA function in Liriodendron tulipifera?

CRISPR-Cas9 technologies offer unprecedented opportunities for precise genetic manipulation to study ndhA function in Liriodendron tulipifera:

  • Targeted Mutagenesis Strategies:

    • Design sgRNAs targeting conserved domains within ndhA

    • Create specific point mutations to analyze structure-function relationships

    • Generate truncation variants to identify essential protein regions

    • Develop conditional knockout systems for temporal control of ndhA expression

  • Promoter Editing Applications:

    • Modify native ndhA promoter to alter expression levels

    • Create inducible expression systems for temporal studies

    • Engineer tissue-specific expression to study organ-specific functions

    • Introduce reporter gene fusions for expression monitoring

  • Base Editing Technologies:

    • Apply cytosine or adenine base editors for precise nucleotide modifications

    • Create specific amino acid substitutions without double-strand breaks

    • Engineer modifications mirroring natural variants found in related species

    • Generate synthetic variants to test evolutionary hypotheses

  • Technical Considerations for Woody Species:

    • Develop optimized protoplast isolation protocols from L. tulipifera tissues

    • Establish efficient regeneration systems following genome editing

    • Implement high-throughput screening methods for edited plants

    • Combine with chloroplast transformation technologies for comprehensive studies

This CRISPR-based approach will enable researchers to move beyond correlative studies to establish causal relationships between ndhA sequence, structure, and function in L. tulipifera, particularly in the context of its remarkably conserved genome .

What comparative genomic approaches can elucidate the evolutionary conservation of ndhA across plant species?

Comparative genomic approaches offer powerful insights into the evolutionary conservation of ndhA across plant species, with Liriodendron tulipifera serving as a valuable reference point:

  • Phylogenomic Analysis Framework:

    • Construct comprehensive phylogenetic trees using ndhA sequences from diverse plant lineages

    • Implement maximum likelihood and Bayesian inference methods

    • Calculate selective pressure (dN/dS ratios) across different domains

    • Identify sites under positive or purifying selection

  • Structural Conservation Assessment:

    • Apply homology modeling to predict ndhA protein structures across species

    • Conduct molecular dynamics simulations to evaluate structural stability

    • Identify conserved residues critical for function through ConSurf analysis

    • Map conservation patterns onto three-dimensional structures

  • Synteny and Gene Order Analysis:

    • Compare chloroplast genome organization around the ndhA locus

    • Identify conserved gene clusters and regulatory elements

    • Analyze genomic rearrangements affecting ndhA expression

    • Determine correlation between genome organization and functional constraints

  • Transcriptomic Comparative Approaches:

    • Compare ndhA expression patterns across species under similar conditions

    • Identify conserved regulatory networks controlling expression

    • Analyze co-expression patterns with other photosynthetic genes

    • Determine expression plasticity in response to environmental factors

This comparative framework leverages L. tulipifera's position as a basal angiosperm with a highly conserved genome to provide evolutionary context for ndhA function. The extraordinarily low genome-wide silent substitution rate in L. tulipifera makes it an ideal reference point for understanding how selective pressures have shaped the evolution of photosynthetic machinery across flowering plants .

What advanced spectroscopic methods can effectively characterize ndhA function in intact chloroplasts?

Advanced spectroscopic methods offer non-invasive approaches to characterize ndhA function in intact chloroplasts:

  • Pulse Amplitude Modulation (PAM) Fluorometry:

    • Measure NDH-dependent post-illumination chlorophyll fluorescence rise

    • Quantify cyclic electron flow rates around PSI

    • Assess NDH contribution to non-photochemical quenching

    • Analyze recovery kinetics after photoinhibition

  • Time-Resolved Absorption Spectroscopy:

    • Monitor P700 redox kinetics to quantify PSI electron transport

    • Measure plastoquinone reduction/oxidation rates

    • Determine electron transfer rates through specific complexes

    • Assess NDH complex contribution to the proton gradient

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Detect transient radical species involved in electron transport

    • Characterize iron-sulfur clusters within the NDH complex

    • Monitor electron flow through specific redox-active cofactors

    • Identify specific electron transfer pathways affected by ndhA mutations

  • Förster Resonance Energy Transfer (FRET) Analysis:

    • Engineer fluorescent protein fusions to ndhA and interaction partners

    • Measure interaction dynamics in vivo using fluorescence lifetime imaging

    • Quantify conformational changes under various conditions

    • Assess complex assembly in real-time

  • Experimental Design Considerations:

    • Conduct measurements under various light intensities (50-1000 μmol m⁻² s⁻¹)

    • Assess temperature dependence of NDH activity (15-35°C)

    • Compare wild-type and ndhA-modified plants under identical conditions

    • Analyze responses to environmental stresses (drought, temperature extremes)

These spectroscopic approaches provide comprehensive insights into ndhA function while maintaining the native environment of the chloroplast, enabling researchers to correlate molecular mechanisms with physiological responses .

How can researchers effectively design experiments to evaluate ndhA's role in environmental stress responses?

Designing experiments to evaluate ndhA's role in environmental stress responses requires multifaceted approaches that integrate molecular, physiological, and ecological perspectives:

  • Controlled Environment Experimental Design:

    • Implement factorial designs testing multiple stress variables (temperature, light, drought)

    • Conduct time-course experiments to capture dynamic responses

    • Include recovery phases to assess resilience mechanisms

    • Maintain consistent non-stress control conditions for comparison

  • Field-to-Lab Transition Studies:

    • Compare L. tulipifera specimens from diverse habitats

    • Collect ecotypes from different elevations and latitudes

    • Transfer plants between controlled and natural environments

    • Correlate genetic variation with physiological performance

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics analyses

    • Track changes in ndhA expression, protein abundance, and activity

    • Identify regulatory networks controlling NDH complex function

    • Correlate molecular changes with physiological responses

  • Physiological Measurements Panel:

MeasurementTechniqueParametersRelevance to ndhA
Photosynthetic efficiencyPAM fluorometryFv/Fm, NPQ, ETRAssesses photosystem II performance under stress
Cyclic electron flowP700 absorbanceY(ND), Y(NA), CEF rateDirectly measures ndhA-dependent processes
Reactive oxygen speciesFluorescent probesH₂O₂, O₂⁻, OH⁻ levelsQuantifies oxidative stress protection
Carbon assimilationGas exchangeA/Ci curves, stomatal conductanceLinks electron transport to productivity
Growth parametersMorphometric analysisBiomass, height, leaf areaConnects molecular function to whole-plant performance
  • Statistical Analysis Framework:

    • Apply mixed-effects models to account for random factors

    • Implement repeated measures ANOVA for time-course data

    • Use principal component analysis to identify major response patterns

    • Develop structural equation models to test causal relationships

This comprehensive experimental framework enables researchers to establish clear connections between ndhA function at the molecular level and L. tulipifera's remarkable adaptability to diverse environmental conditions, contributing to its success as a long-lived, deciduous tree native to eastern North America .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.