Recombinant Liriodendron tulipifera NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the enzyme's primary electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Liriodendron tulipifera and why is it significant for recombinant protein research?

Liriodendron tulipifera, commonly known as the tulip tree or yellow poplar, is a flowering tree native to eastern North America belonging to the Magnoliaceae family. Despite its common name "tulip poplar," it is neither a tulip nor a poplar but rather a relative of the magnolia tree . This species is significant for recombinant protein research due to several unique characteristics:

  • It is a long-lived species that can survive up to 500 years in optimal conditions, making it valuable for studying long-term genetic adaptation mechanisms .

  • It demonstrates exceptional morphological features, including distinct tulip-shaped flowers and goose web-like leaves, making it suitable for developmental biology studies .

  • The tree reaches heights of 80-100 feet on average (potentially up to 200 feet), providing abundant biomass for protein extraction .

  • As a native North American species and the state tree of Indiana, Kentucky, and Tennessee, it represents an important ecological and genetic resource for native plant biotechnology .

When working with recombinant proteins from L. tulipifera, researchers must consider the species' unique genetic characteristics and cellular machinery that may influence protein expression and function.

What is the role of NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in chloroplast function?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplastic NDH complex that functions in cyclic electron transport around photosystem I. The protein plays several essential roles in plant physiology:

  • It participates in proton translocation across the thylakoid membrane, contributing to ATP synthesis during photosynthesis.

  • It helps regulate the redox state of the plastoquinone pool, which serves as an electron carrier in photosynthetic electron transport.

  • It provides protection against photo-oxidative stress under high light conditions by preventing over-reduction of electron transport components.

  • It contributes to plant adaptation to various environmental stresses, including drought, high light, and temperature fluctuations.

Understanding the function of ndhC within the chloroplastic NDH complex provides valuable insights into photosynthetic efficiency and stress response mechanisms in woody plants like L. tulipifera. Research on this protein offers opportunities to explore how temperate deciduous trees optimize photosynthetic performance under variable environmental conditions.

How do NIH guidelines apply to research involving recombinant Liriodendron tulipifera proteins?

Research involving recombinant Liriodendron tulipifera proteins, including ndhC, must adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines cover the practices for constructing and handling recombinant nucleic acid molecules, synthetic nucleic acid molecules (including those chemically modified but able to base pair with naturally occurring nucleic acids), and cells, organisms, and viruses containing such molecules .

The guidelines apply to institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids, unless specifically exempted . Key considerations include:

  • All recombinant DNA protocols must be reviewed by an Institutional Biosafety Committee (IBC), regardless of whether synthetic techniques are also employed .

  • The guidelines apply to research involving either recombinant or synthetic nucleic acid molecules (or both in combination) unless specifically exempted under conditions listed in Section III-F of the guidelines .

  • Researchers must follow appropriate biosafety containment procedures regardless of whether the agent was generated via recombinant or synthetic techniques .

  • The guidelines define recombinant and synthetic nucleic acid molecules as those constructed by joining nucleic acid molecules that can replicate in living cells, or that are chemically synthesized or amplified and can base pair with naturally occurring nucleic acid molecules .

Compliance with these guidelines ensures safe and responsible research practices when working with recombinant proteins from L. tulipifera.

What are the optimal methods for isolating and cloning the ndhC gene from Liriodendron tulipifera?

The isolation and cloning of ndhC gene from Liriodendron tulipifera requires a systematic approach based on established molecular techniques. Drawing from successful gene isolation methods used for other L. tulipifera genes, such as LtuJAG , the following protocol is recommended:

  • Sample collection and preparation:

    • Collect fresh leaf buds from healthy L. tulipifera trees, as chloroplast genes are abundantly expressed in photosynthetic tissues.

    • Immediately flash-freeze samples in liquid nitrogen and store at -80°C to preserve RNA integrity.

  • RNA extraction and cDNA synthesis:

    • Extract total RNA using a commercial kit (e.g., Tiangen total RNA extraction kit) following manufacturer's instructions .

    • Assess RNA quality using spectrophotometry (A260/A280 ratio) and gel electrophoresis.

    • Synthesize first-strand cDNA using a reverse transcription kit (e.g., PrimeScript II 1st strand cDNA Synthesis Kit, TaKaRa) .

  • Gene amplification strategies:

    • Design primers based on conserved regions of ndhC genes from related species.

    • Perform PCR amplification with initial denaturation at 95°C for 60s, followed by 40 cycles of 5s at 95°C and 34s at 60°C .

    • Use high-fidelity DNA polymerase to minimize amplification errors.

  • Cloning procedure:

    • Ligate the amplified product into an appropriate vector (e.g., pMD19-T).

    • Transform into competent E. coli cells.

    • Confirm successful transformation through colony PCR and sequencing.

  • Sequence verification:

    • Analyze the sequence to confirm identity with known ndhC genes.

    • Use bioinformatic tools to identify conserved domains and functional motifs.

This methodology ensures the isolation of the complete ndhC gene with high fidelity, providing a foundation for subsequent recombinant expression studies.

What expression systems are most effective for producing recombinant L. tulipifera ndhC protein?

The selection of an appropriate expression system for recombinant L. tulipifera ndhC protein production requires careful consideration of multiple factors including protein localization, post-translational modifications, and functional requirements. Based on chloroplastic protein expression studies, the following systems offer distinct advantages:

  • Bacterial expression systems (E. coli):

    • Advantages: Rapid growth, high yield, cost-effective, well-established protocols.

    • Limitations: Lack of post-translational modifications, potential for inclusion body formation.

    • Optimization strategies: Use specialized strains (e.g., BL21(DE3)pLysS) for membrane proteins; employ fusion tags (MBP, SUMO) to enhance solubility; optimize codon usage for chloroplast proteins.

  • Plant-based expression systems:

    • Advantages: Native post-translational modifications, proper protein folding, appropriate subcellular targeting.

    • Methods:

      • Transient expression in Nicotiana benthamiana using Agrobacterium-mediated transformation (similar to methods used for LtuJAG expression studies) .

      • Stable transformation of Arabidopsis thaliana for long-term studies.

    • Conditions: Grow plants under controlled light (16h light/8h dark cycle) and temperature (22°C) conditions.

  • Chloroplast transformation systems:

    • Advantages: High-level expression, proper folding environment for chloroplastic proteins.

    • Procedure: Direct transformation of chloroplast genome using particle bombardment.

    • Verification: Confirm chloroplast transformation using PCR and Southern blotting.

  • Cell-free protein synthesis:

    • Advantages: Rapid production, avoids toxicity issues, suitable for membrane proteins.

    • Components: Use chloroplast extracts to provide appropriate translation machinery.

The choice of expression system should be guided by the specific research objectives. For functional studies, plant-based systems may be preferable despite lower yields, while bacterial systems may be suitable for structural studies requiring larger protein quantities.

What techniques are most suitable for purifying recombinant L. tulipifera ndhC protein?

Purifying recombinant L. tulipifera ndhC protein presents unique challenges due to its chloroplastic membrane-associated nature. A multi-step purification approach is recommended:

  • Initial extraction and solubilization:

    • For plant-expressed protein: Isolate intact chloroplasts using Percoll gradient centrifugation before protein extraction.

    • For bacterial systems: Use gentle detergents (DDM, LDAO, or digitonin) to solubilize membrane fractions.

    • Buffer composition: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, 1 mM EDTA, protease inhibitor cocktail.

  • Affinity chromatography:

    • Design constructs with affinity tags (His6, Strep-tag II, or FLAG) positioned to avoid interference with protein function.

    • Use Ni-NTA resin for His-tagged proteins with optimized imidazole concentrations (10-20 mM in washing buffer, 250-300 mM for elution).

    • For improved purity, consider dual affinity tags (His-MBP or His-SUMO).

  • Secondary purification:

    • Ion exchange chromatography: Use DEAE or Q-Sepharose columns based on the theoretical pI of ndhC.

    • Size exclusion chromatography: Separate monomeric from aggregated forms using Superdex 200 columns.

  • Quality assessment:

    • SDS-PAGE and western blotting to confirm protein identity and purity.

    • Mass spectrometry for accurate molecular weight determination and verification of post-translational modifications.

    • Circular dichroism spectroscopy to assess secondary structure.

  • Storage conditions:

    • Store purified protein in buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and appropriate detergent at concentrations above CMC.

    • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots to avoid freeze-thaw cycles.

This comprehensive purification strategy ensures isolation of functional ndhC protein suitable for subsequent biochemical and structural analyses.

How does the structure of L. tulipifera ndhC compare to homologous proteins in other plant species?

The structural comparison of L. tulipifera ndhC with homologous proteins from other plant species reveals important evolutionary adaptations and functional conservation patterns. Based on comprehensive sequence and structural analyses:

  • Sequence conservation:

    • Core transmembrane domains show high conservation (>70% identity) across angiosperms.

    • The N-terminal region exhibits greater variability, potentially reflecting species-specific regulatory mechanisms.

    • Key residues involved in quinone binding sites are strictly conserved across all plant species.

  • Structural features:

    • L. tulipifera ndhC contains predicted transmembrane helices that anchor the protein within the thylakoid membrane.

    • The protein adopts an α-helical fold characteristic of membrane-spanning subunits in respiratory and photosynthetic complexes.

    • Comparative modeling suggests structural similarity to cyanobacterial homologs, reflecting the endosymbiotic origin of chloroplasts.

  • Functional domains:

    • The quinone-binding pocket architecture is conserved between L. tulipifera and other angiosperms.

    • Residues involved in proton pumping show positional conservation despite sequence variations.

    • Species-specific variations occur primarily in loop regions connecting transmembrane segments.

  • Phylogenetic considerations:

    • As a member of the ancient Magnoliaceae family, L. tulipifera ndhC represents an important evolutionary link between early-diverging angiosperms and more derived lineages.

    • Structural comparison reveals that core functional elements were established early in land plant evolution.

Understanding these structural relationships provides valuable insights into the evolutionary constraints on ndhC and helps identify regions that may be responsible for species-specific adaptations in photosynthetic efficiency and stress responses.

What are the experimental challenges in assessing the enzymatic activity of recombinant L. tulipifera ndhC?

Assessing the enzymatic activity of recombinant L. tulipifera ndhC presents several complex challenges that require sophisticated experimental approaches:

  • Integration into the multi-subunit NDH complex:

    • ndhC functions as part of the larger NDH complex, making isolated activity measurements difficult.

    • Solution: Reconstitution experiments combining recombinant ndhC with other NDH subunits or using partially assembled subcomplexes.

    • Challenge: Ensuring proper assembly of the reconstituted complex in an artificial environment.

  • Maintenance of native conformation:

    • As a membrane protein, ndhC requires a lipid environment for proper folding and function.

    • Approaches:

      • Incorporation into liposomes or nanodiscs to mimic the thylakoid membrane environment.

      • Use of mild detergents (digitonin, DDM) to maintain structural integrity during purification.

    • Assessment: Circular dichroism spectroscopy to verify secondary structure in different membrane-mimetic environments.

  • Electron transfer measurements:

    • Direct measurement of NAD(P)H oxidation and quinone reduction.

    • Methods:

      • Spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm.

      • Polarographic measurements of oxygen consumption.

      • EPR spectroscopy to monitor electron transfer through the complex.

    • Controls: Use specific inhibitors (rotenone, piericidin A) to distinguish NDH activity from other oxidoreductases.

  • Proton translocation assessment:

    • Measuring proton movement across membranes.

    • Techniques:

      • pH-sensitive fluorescent dyes (ACMA, pyranine) in liposome-reconstituted systems.

      • Patch-clamp electrophysiology for direct current measurements.

  • Artificial electron donors/acceptors:

    • Natural substrates may have limited stability or availability.

    • Alternatives: Use of synthetic quinone analogs (decylubiquinone, duroquinone) as electron acceptors.

    • Validation: Compare kinetics with native and artificial substrates to ensure physiological relevance.

These methodological approaches and considerations provide a framework for accurately assessing the enzymatic properties of recombinant L. tulipifera ndhC, enabling meaningful comparison with homologous proteins from other species.

How can researchers effectively use site-directed mutagenesis to study the function of L. tulipifera ndhC?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in L. tulipifera ndhC. A systematic mutagenesis strategy involves:

  • Target site selection:

    • Conserved residues: Identify amino acids conserved across species using multiple sequence alignments.

    • Predicted functional domains: Target residues in quinone-binding sites, proton channels, and subunit interaction interfaces.

    • Structural motifs: Focus on residues in transmembrane regions and loop structures connecting helices.

  • Mutagenesis strategy:

    • Conservative substitutions: Replace amino acids with those of similar properties to assess subtle functional effects.

    • Non-conservative changes: Introduce dramatically different residues to disrupt specific functions.

    • Alanine-scanning: Systematically replace residues with alanine to identify essential amino acids.

    • Techniques: Use PCR-based methods (QuikChange) or Gibson Assembly for introducing mutations.

  • Expression and functional analysis:

    • Express mutant proteins in appropriate systems (similar to those used for LtuJAG gene studies) .

    • Perform comparative analysis of wild-type and mutant proteins:

      • Structural integrity assessment using circular dichroism and thermal stability assays.

      • Enzymatic activity measurements using methods outlined in section 3.2.

      • Complex assembly analysis using Blue Native PAGE and co-immunoprecipitation.

  • In vivo functional complementation:

    • Systems: Transform Arabidopsis ndhC mutants with wild-type and mutant L. tulipifera ndhC.

    • Phenotypic analysis: Measure photosynthetic parameters, stress response, and growth characteristics.

    • Molecular markers: Monitor expression of stress-responsive genes and photosynthetic efficiency markers.

  • Data interpretation framework:

    • Correlate structural location of mutations with observed functional changes.

    • Develop a comprehensive map of residue functions within the protein.

    • Build predictive models of structure-function relationships.

This systematic approach to site-directed mutagenesis enables detailed characterization of critical residues in L. tulipifera ndhC, providing insights into both conserved functions and species-specific adaptations in this important chloroplastic protein.

What are common problems encountered during recombinant expression of L. tulipifera ndhC and how can they be addressed?

Recombinant expression of L. tulipifera ndhC frequently encounters challenges that require specific troubleshooting strategies:

ProblemPossible CausesSolutions
Low expression yield- Codon bias
- Toxicity to host
- Protein instability
- Optimize codon usage for expression host
- Use tightly regulated inducible promoters
- Co-express with molecular chaperones (GroEL/ES, DnaK)
- Lower induction temperature (16-20°C)
Protein insolubility- Hydrophobic transmembrane domains
- Improper folding
- Aggregation
- Use specific detergents (DDM, LDAO) during extraction
- Express as fusion with solubility-enhancing tags (MBP, SUMO)
- Include mild solubilizing agents (glycerol, arginine) in buffers
Degradation- Proteolytic susceptibility
- Structural instability
- Add protease inhibitor cocktails
- Use protease-deficient expression strains
- Optimize buffer conditions (pH, salt concentration)
- Maintain low temperature during purification
Lack of activity- Incorrect folding
- Missing cofactors
- Absence of other complex subunits
- Add potential cofactors during purification
- Consider co-expression with partner subunits
- Reconstitute in lipid environments mimicking thylakoid membrane
Aggregation during purification- Detergent removal
- Concentration effects
- Maintain detergent above critical micelle concentration
- Use stabilizing additives (glycerol, sucrose)
- Employ gradient dialysis for detergent exchange

These troubleshooting strategies address the most common challenges in working with this chloroplastic membrane protein, facilitating successful expression and purification for subsequent functional studies.

How can researchers verify the proper folding and assembly of recombinant L. tulipifera ndhC?

Verifying the proper folding and assembly of recombinant L. tulipifera ndhC requires multiple complementary approaches:

These methods provide comprehensive assessment of protein folding quality and functional integrity, essential for ensuring that subsequent functional studies are performed with properly folded and assembled recombinant L. tulipifera ndhC protein.

What strategies can be employed to optimize the yield of functional L. tulipifera ndhC protein?

Optimizing the yield of functional L. tulipifera ndhC protein requires a multi-faceted approach addressing expression, purification, and stabilization factors:

  • Expression optimization:

    • Promoter selection: Compare constitutive vs. inducible promoters (T7, tac, AOX1) to identify optimal expression control.

    • Host strain engineering:

      • For bacterial systems: Use C41(DE3) or C43(DE3) strains designed for membrane protein expression.

      • For yeast: Select strains with reduced proteolytic activity (SMD1163, BJ5465).

      • For plant systems: Consider chloroplast transformation for direct targeting.

    • Culture conditions:

      • Lower growth temperature (16-20°C) during induction to slow translation and allow proper folding.

      • Optimize induction timing based on growth phase monitoring.

      • Supplement media with specific additives (e.g., δ-aminolevulinic acid for heme-containing proteins).

  • Genetic construct design:

    • Codon optimization: Adapt codons to expression host preferences without altering rare codons critical for proper folding.

    • Fusion tags: Test multiple tags (His6, Strep-II, FLAG, MBP) at both N- and C-termini to identify optimal configurations.

    • Signal sequences: Include appropriate targeting sequences for membrane insertion or chloroplast localization.

  • Extraction and purification refinement:

    • Detergent screening: Systematically test detergents (DDM, LDAO, OG, digitonin) for optimal extraction efficiency while maintaining function.

    • Stabilizing additives: Include glycerol (5-10%), specific lipids (POPC, POPE), and osmolytes (trehalose, sucrose) in purification buffers.

    • Chromatography optimization: Develop tailored protocols combining affinity, ion exchange, and size exclusion techniques.

  • Co-expression strategies:

    • Molecular chaperones: Co-express with GroEL/ES or Hsp70 system components.

    • Partner subunits: Consider co-expression with interacting NDH complex subunits to promote proper assembly.

    • Stabilizing factors: Include known stabilizing proteins or antibody fragments.

  • Scale-up considerations:

    • Bioreactor parameters: Optimize dissolved oxygen levels, pH, and feeding strategies for large-scale production.

    • Continuous processing: Implement continuous extraction and purification workflows to minimize degradation time.

These comprehensive optimization strategies address the inherent challenges of expressing chloroplastic membrane proteins, enabling researchers to obtain sufficient quantities of functional L. tulipifera ndhC for detailed biochemical and structural studies.

How should researchers analyze and interpret kinetic data for recombinant L. tulipifera ndhC?

The analysis and interpretation of kinetic data for recombinant L. tulipifera ndhC requires rigorous methodological approaches and careful consideration of the protein's complex nature:

  • Steady-state kinetics analysis:

    • Data collection: Measure initial reaction rates across a range of substrate concentrations under controlled conditions.

    • Mathematical models:

      • Apply Michaelis-Menten, Hill, or ping-pong bi-bi models depending on reaction mechanism.

      • Use non-linear regression to determine key parameters (Km, kcat, Vmax).

      • Calculate catalytic efficiency (kcat/Km) to assess substrate preference.

    • Interpretation framework:

      • Compare parameters with those of homologous proteins from other species.

      • Correlate with physiological substrate concentrations in chloroplasts.

      • Consider the influence of detergents or lipid environments on parameter values.

  • Inhibition studies:

    • Approach: Test known inhibitors (rotenone, piericidin A) across concentration ranges.

    • Analysis methods:

      • Determine inhibition constants (Ki) and inhibition modality (competitive, non-competitive, uncompetitive).

      • Create Dixon or Lineweaver-Burk plots for visual representation of inhibition patterns.

    • Interpretation: Use inhibition patterns to infer binding site locations and conformational changes.

  • Environmental effects assessment:

    • Variables to test: pH, temperature, ionic strength, lipid composition.

    • Analysis:

      • Generate pH-activity and temperature-activity profiles.

      • Determine thermodynamic parameters (activation energy, ΔH, ΔS) from temperature dependence.

    • Biological context: Relate optimal conditions to chloroplast physiological environment.

  • Data validation and quality control:

    • Statistical analysis: Apply appropriate statistical tests (ANOVA, t-tests) to assess significance.

    • Control experiments: Include enzyme-free and substrate-free controls.

    • Replicate design: Perform biological triplicates and technical duplicates at minimum.

  • Integrated data interpretation:

    • Correlate kinetic parameters with structural features.

    • Compare with photosynthetic efficiency measurements in vivo.

    • Consider how L. tulipifera's ecological niche might influence observed kinetic properties.

This systematic approach to kinetic data analysis provides meaningful insights into the functional properties of recombinant L. tulipifera ndhC, establishing connections between molecular activity and physiological role in photosynthetic electron transport.

What computational tools and resources are valuable for studying L. tulipifera ndhC structure and function?

Researchers investigating L. tulipifera ndhC can leverage a diverse array of computational tools and resources to elucidate structure, function, and evolutionary relationships:

  • Sequence analysis tools:

    • Multiple sequence alignment: MUSCLE, MAFFT, and Clustal Omega for comparative analysis with homologs.

    • Conservation mapping: ConSurf, Scorecons to identify functionally important residues.

    • Domain prediction: InterProScan, SMART for identifying functional domains and motifs.

    • Transmembrane topology: TMHMM, TOPCONS, and MEMSAT for membrane-spanning region prediction.

  • Structural prediction and analysis:

    • 3D structure prediction:

      • AlphaFold2 and RoseTTAFold for generating accurate structural models.

      • I-TASSER and SWISS-MODEL for template-based modeling.

      • MEMOIR and MINNOU specifically optimized for membrane protein prediction.

    • Model validation: PROCHECK, VERIFY3D, and MolProbity for quality assessment.

    • Molecular visualization: PyMOL, UCSF Chimera, and VMD for structural inspection and analysis.

  • Molecular simulation resources:

    • Molecular dynamics packages: GROMACS, NAMD, and AMBER for simulating protein dynamics in membrane environments.

    • Specialized force fields: CHARMM36m, Amber Lipid17, and Martini for membrane protein simulations.

    • Enhanced sampling: Metadynamics and umbrella sampling for exploring conformational changes.

  • Functional prediction tools:

    • Ligand binding site prediction: CASTp, FTSite, and COACH for identifying potential quinone binding regions.

    • Protein-protein interaction: HADDOCK, ClusPro, and ZDOCK for modeling interactions with other NDH complex subunits.

    • Electrostatics calculation: APBS and DelPhi for mapping charge distribution and proton channels.

  • Databases and repositories:

    • Specialized databases: UniProt, TAIR, and 1KP (One Thousand Plant Transcriptomes) for sequence information.

    • Structural databases: PDB and EMDB for related experimental structures.

    • Plant-specific resources: Phytozome, PLAZA, and GreenPhylDB for comparative genomics.

These computational resources provide powerful means to generate testable hypotheses about L. tulipifera ndhC structure and function, complementing experimental approaches and guiding laboratory investigations. Integrating predictions from multiple tools increases confidence in results and helps identify high-priority targets for experimental validation.

How can researchers correlate in vitro findings with the physiological role of ndhC in L. tulipifera?

Bridging the gap between in vitro biochemical data and physiological relevance requires integrative approaches that connect molecular mechanisms to whole-plant function:

  • Transgenic complementation studies:

    • Experimental design: Introduce L. tulipifera ndhC into model plant species with ndhC knockouts.

    • Parameters to measure:

      • Photosynthetic efficiency (Fv/Fm, ΦPSII, NPQ) under varying light conditions.

      • Growth rates and biomass accumulation under different environmental stresses.

      • Chlorophyll fluorescence induction kinetics to assess electron transport.

    • Analysis approach: Compare wild-type, knockout, and complemented lines to assess functional restoration.

  • Environmental response profiling:

    • Stress conditions: Expose plants to drought, high light, temperature extremes, and fluctuating light.

    • Molecular markers: Monitor expression of stress-responsive genes alongside ndhC expression.

    • Physiological measurements:

      • Gas exchange parameters (CO2 assimilation, transpiration).

      • Reactive oxygen species (ROS) production and antioxidant enzyme activities.

      • Cyclic electron flow rates using spectroscopic methods.

    • Correlation analysis: Relate environmental response phenotypes to ndhC structural features and in vitro activity.

  • Multi-level omics integration:

    • Transcriptomics: RNA-seq to identify genes co-regulated with ndhC under various conditions.

    • Proteomics: Quantify changes in NDH complex subunit abundance and post-translational modifications.

    • Metabolomics: Measure metabolic shifts in response to altered ndhC function.

    • Data integration: Use network analysis to connect molecular changes to physiological outcomes.

  • Electron transport chain analysis:

    • In vivo spectroscopy: Monitor P700 redox kinetics to assess cyclic electron flow.

    • Thylakoid membrane isolation: Compare electron transport rates in isolated thylakoids.

    • Comparative analysis: Correlate in vitro kinetic parameters with in vivo electron transport measurements.

  • Ecological context consideration:

    • Habitat adaptation: Relate L. tulipifera ndhC properties to the species' natural environment.

    • Comparative ecology: Contrast with ndhC function in plants from different ecological niches.

    • Seasonal variation: Examine ndhC expression and activity across seasons and developmental stages.

This comprehensive framework allows researchers to validate the physiological significance of biochemical findings, ensuring that insights gained from recombinant protein studies accurately reflect the protein's role in living organisms. The integration of molecular, cellular, and organismal data provides a holistic understanding of L. tulipifera ndhC function in plant adaptation and survival.

What are the most promising future research directions for L. tulipifera ndhC studies?

The study of recombinant Liriodendron tulipifera NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) offers several promising research avenues that could significantly advance our understanding of plant photosynthesis, stress adaptation, and evolution:

  • Structural biology breakthroughs:

    • High-resolution structure determination of the entire NDH complex from L. tulipifera using cryo-electron microscopy.

    • Comparative structural analysis across diverse plant species to identify evolutionary adaptations.

    • Time-resolved structural studies to capture conformational changes during the catalytic cycle.

  • Systems biology integration:

    • Comprehensive modeling of how ndhC function influences whole-plant carbon fixation and energy balance.

    • Network analysis connecting ndhC activity to broader stress response pathways in woody perennials.

    • Multi-omics approaches to understand regulatory mechanisms controlling NDH complex assembly and function.

  • Climate adaptation research:

    • Investigation of how ndhC variants influence adaptation to changing climate conditions in different L. tulipifera populations.

    • Comparative studies of ndhC function in closely related species from varied environmental niches.

    • Long-term studies leveraging L. tulipifera's longevity to understand adaptation mechanisms over time.

  • Biotechnological applications:

    • Engineering optimized ndhC variants to enhance photosynthetic efficiency under stress conditions.

    • Development of ndhC-based biosensors for monitoring chloroplast redox state.

    • Exploration of ndhC's potential role in improving bioenergy production in woody perennials.

  • Evolutionary biology insights:

    • Detailed analysis of ndhC evolution across the plant kingdom, with focus on adaptations in early-diverging angiosperms like L. tulipifera.

    • Investigation of how ndhC function relates to the evolutionary success of the Magnoliaceae family.

    • Molecular clock analyses to understand the tempo of ndhC evolution in relation to changing environmental conditions.

These research directions promise to advance both fundamental understanding of photosynthetic processes and applied knowledge for addressing challenges in forestry, conservation, and sustainable agriculture in a changing climate.

How can findings from L. tulipifera ndhC research contribute to broader plant science and biotechnology?

Research on Liriodendron tulipifera ndhC has far-reaching implications that extend beyond the specific protein to impact multiple domains of plant science and biotechnology:

  • Photosynthesis enhancement strategies:

    • Insights from L. tulipifera ndhC function can inform genetic engineering approaches to optimize cyclic electron flow.

    • Understanding adaptive variations may reveal natural mechanisms for photosynthetic efficiency improvement in crop species.

    • The structure-function relationships uncovered could guide rational design of enhanced photosynthetic complexes.

  • Stress tolerance improvement:

    • Mechanisms by which L. tulipifera ndhC contributes to stress adaptation in a long-lived tree species may inform stress-tolerant crop development.

    • Identification of regulatory networks controlling ndhC expression under stress conditions can reveal new targets for crop improvement.

    • Comparative studies between annual crops and perennial trees can identify transferable stress adaptation strategies.

  • Evolutionary and ecological insights:

    • As a member of an ancient angiosperm lineage, L. tulipifera ndhC provides a window into early plant evolution.

    • Understanding ndhC function in natural ecosystems contributes to forest ecosystem management strategies.

    • Connecting molecular function to ecological adaptation improves models of plant responses to global change.

  • Methodology advancement:

    • Techniques developed for L. tulipifera ndhC expression and analysis can be applied to other challenging membrane proteins.

    • Computational approaches refined for ndhC structural prediction can benefit the broader field of chloroplast protein research.

    • Integration methods linking molecular data to physiology provide templates for systems biology approaches.

  • Bioenergy applications:

    • Knowledge of electron transport mechanisms in woody perennials can inform bioenergy feedstock development.

    • Understanding photosynthetic efficiency regulation may contribute to improving carbon capture in biomass production systems.

    • Long-term sustainability insights from studying ancient tree species can guide bioenergy crop management practices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.