Recombinant Liriodendron tulipifera NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
ndhE
Target Protein Sequence
MMTEHVLILSAYLFSIGIYGLITSRNMVRALMCLELILNAVNLNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone to quinones within the photosynthetic and possibly chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the expression pattern of ndhE compare to other chloroplastic genes in Liriodendron tulipifera?

While specific expression data for ndhE is limited in the provided sources, chloroplastic genes in Liriodendron tulipifera typically follow tissue-specific and developmental expression patterns. Based on research with other chloroplastic genes in this species (such as TPS32), expression can vary significantly across different tissues and developmental stages. For instance, some chloroplastic genes in L. tulipifera show highest expression in photosynthetically active tissues and during specific developmental periods .

Researchers investigating ndhE expression should consider utilizing RT-qPCR across different tissues and developmental stages, similar to methods employed for other L. tulipifera genes, to establish tissue-specific expression patterns. Comparison with other chloroplastic genes would provide valuable context for understanding ndhE's role in plant metabolism.

What are the optimal conditions for expressing recombinant L. tulipifera ndhE protein in E. coli systems?

For optimal expression of recombinant L. tulipifera ndhE protein in E. coli, researchers should consider the following methodological approach:

  • Codon optimization: Since accessibility of translation initiation sites significantly impacts protein expression success, researchers should optimize the first 9 codons of the ndhE sequence using tools like TIsigner that analyze mRNA base-unpairing across the Boltzmann's ensemble .

  • Expression vector selection: Choose vectors with strong inducible promoters (such as T7) combined with appropriate fusion tags that facilitate expression of membrane proteins.

  • Host strain selection: BL21(DE3) derivatives optimized for membrane protein expression are recommended, with consideration for strains containing rare codon tRNAs.

  • Culture conditions: Grow cultures at lower temperatures (16-25°C) after induction to slow protein production and facilitate proper folding of this chloroplastic protein.

  • Induction parameters: Use lower IPTG concentrations (0.1-0.5 mM) with extended expression times (16-24 hours) to reduce protein aggregation.

Accessibility of translation initiation sites has been demonstrated to accurately predict success or failure of expression experiments for over 11,430 recombinant proteins from diverse species, making this optimization crucial .

What purification strategies are most effective for recombinant L. tulipifera ndhE protein?

Purifying membrane-associated chloroplastic proteins like ndhE requires specialized approaches:

  • Membrane fraction isolation: After cell lysis, separate membrane fractions through ultracentrifugation (typically 100,000 × g for 1 hour).

  • Detergent solubilization: Test multiple detergents (n-dodecyl-β-D-maltoside, digitonin, or CHAPS) at various concentrations (0.5-2%) to identify optimal solubilization conditions while maintaining protein functionality.

  • Affinity chromatography: Utilize the fusion tag (commonly His6) for initial purification under optimized detergent conditions.

  • Secondary purification: Apply size exclusion chromatography to obtain higher purity and assess protein aggregation state.

  • Quality control: Verify protein identity through mass spectrometry and Western blotting with antibodies specific to ndhE or the fusion tag.

Storage should maintain the recommended conditions for this specific protein: Tris-based buffer with 50% glycerol at -20°C for long-term storage, with working aliquots kept at 4°C for up to one week .

How does the accessibility of translation initiation sites affect the expression efficiency of ndhE protein?

The accessibility of translation initiation sites, modeled as mRNA base-unpairing across the Boltzmann's ensemble, is a critical determinant of expression success for recombinant proteins including ndhE. Research with 11,430 recombinant proteins has demonstrated that this feature significantly outperforms alternative predictors of expression success .

For ndhE protein specifically, researchers should:

  • Calculate initiation site accessibility: Utilize computational tools to assess the base-unpairing probability around the start codon and Shine-Dalgarno sequence.

  • Implement synonymous substitutions: Modify the first 9 codons with synonymous substitutions to optimize accessibility while maintaining amino acid sequence.

  • Quantify expression improvements: Compare expression levels between original and optimized sequences using quantitative Western blotting.

A stochastic simulation model has shown that higher accessibility leads to higher protein production, though with potential tradeoffs in terms of cell growth rate due to the protein cost hypothesis, where cell growth becomes constrained during overexpression .

What methodologies are appropriate for investigating protein-protein interactions of ndhE within the chloroplast NAD(P)H dehydrogenase complex?

To elucidate the protein-protein interactions of ndhE within the chloroplast NAD(P)H dehydrogenase complex, researchers should employ a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against ndhE or its interacting partners to pull down protein complexes, followed by mass spectrometry analysis.

  • Yeast two-hybrid (Y2H) screening: Conduct library screening against other chloroplast proteins to identify direct binding partners.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo verification of interactions in plant systems by fusing potential interacting proteins with complementary fragments of a fluorescent protein.

  • Crosslinking mass spectrometry: Apply chemical crosslinkers to stabilize transient interactions followed by mass spectrometry to identify crosslinked peptides.

  • Blue Native PAGE: Separate intact protein complexes under native conditions to preserve physiological protein associations.

These approaches should be complemented with computational analysis of potential interaction interfaces based on the amino acid sequence and predicted structure of ndhE, particularly focusing on the hydrophobic regions that may mediate interactions within the membrane environment.

How can researchers address experimental variability in functional assays of recombinant ndhE protein?

Addressing experimental variability in functional assays of recombinant ndhE requires systematic approaches:

  • Standardized activity measurements: Establish standardized protocols for measuring NAD(P)H oxidation and quinone reduction activities using spectrophotometric assays.

  • Reference standards: Include positive controls with known activity levels in each experimental batch.

  • Statistical design: Implement proper experimental design with sufficient biological and technical replicates (minimum of 3 biological replicates with 3 technical replicates each).

  • Data normalization strategies:

    • Normalize activity to protein concentration

    • Account for batch effects using statistical approaches like ANOVA

    • Consider regression analysis to identify confounding variables

  • Validation across systems: Compare activity measurements between different expression systems or purification methods to identify system-specific artifacts.

Normalization MethodAdvantagesLimitationsRecommended Application
Protein concentrationSimple, widely acceptedDoesn't account for inactive proteinInitial screening
Active site titrationMeasures functional proteinTechnically challengingDetailed kinetic studies
Internal standardsControls for assay variabilityRequires validated standardsComparative studies
Specific activity ratioAccounts for protein qualityRequires multiple activity measurementsComplex enzymatic studies

What approaches can be used to study the evolutionary conservation of ndhE protein across plant species?

To study evolutionary conservation of ndhE across plant species, researchers should employ a comprehensive phylogenetic approach:

  • Sequence collection: Gather ndhE sequences from diverse plant species representing major evolutionary lineages through databases like UniProt, NCBI, and specialized plant genome databases.

  • Multiple sequence alignment: Align sequences using tools like MUSCLE or MAFFT with parameters optimized for transmembrane proteins.

  • Conservation analysis: Calculate position-specific conservation scores and identify highly conserved motifs potentially critical for function.

  • Selection pressure analysis: Calculate dN/dS ratios to identify positions under purifying or positive selection.

  • Structural mapping: Map conservation data onto predicted structural models to identify functional domains.

  • Comparative expression analysis: Where available, compare expression patterns of ndhE orthologs across species to identify conserved regulatory mechanisms.

Analyzing ndhE within the context of other chloroplastic genes, such as those in the TPS family that have been studied in Liriodendron species, can provide insights into the co-evolution of chloroplast systems. Previous research on Liriodendron has demonstrated the value of comparative genomics for understanding evolutionary relationships and functional conservation .

How might CRISPR-Cas9 technology be applied to study ndhE function in planta?

CRISPR-Cas9 technology offers powerful approaches for studying ndhE function in Liriodendron tulipifera:

  • Knockout generation: Design sgRNAs targeting the ndhE gene with minimal off-target effects, potentially using the following strategy:

    • Target conserved functional domains

    • Validate sgRNA efficiency in protoplasts before whole-plant transformation

    • Screen for homozygous mutants using sequencing

  • Knock-in strategies: Insert reporter genes (like GFP) in-frame with ndhE to study localization and expression dynamics.

  • Base editing applications: Use cytidine or adenine base editors for precise amino acid substitutions to study structure-function relationships.

  • Conditional regulation: Implement CRISPR interference (CRISPRi) or activation (CRISPRa) systems for temporal control of ndhE expression.

  • Phenotypic analysis pipeline:

    • Measure photosynthetic parameters (chlorophyll fluorescence, P700 redox kinetics)

    • Assess plant growth under varying light and stress conditions

    • Analyze cyclic electron flow capacity

    • Quantify alterations in other chloroplastic proteins

This approach would complement studies of other chloroplastic genes like TPS32 in Liriodendron species, which have already yielded insights into interspecific differences in chloroplast function .

What are the methodological considerations for investigating the role of ndhE in plant stress responses?

Investigating the role of ndhE in plant stress responses requires a multi-level experimental design:

  • Stress treatment design:

    • Apply graduated levels of abiotic stressors (drought, high light, temperature extremes)

    • Implement both acute and chronic stress regimes

    • Include recovery phases to assess resilience

  • Physiological measurements:

    • Chlorophyll fluorescence parameters (Fv/Fm, NPQ, ETR)

    • Gas exchange measurements

    • ROS detection and quantification

    • Electron transport rates through PSI and PSII

  • Molecular analyses:

    • Quantitative expression analysis of ndhE and related genes under stress

    • Protein abundance measurements using Western blotting

    • Post-translational modification assessment (phosphorylation, redox state)

    • Protein-protein interaction changes under stress

  • Genetic approaches:

    • Compare wild-type with ndhE mutants or plants with altered ndhE expression

    • Complementation studies to confirm phenotype specificity

    • Cross-species comparison to identify conserved stress response mechanisms

This methodological framework allows researchers to connect molecular changes in ndhE to physiological outcomes, providing mechanistic insight into how this chloroplastic protein contributes to stress tolerance in Liriodendron tulipifera.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.