Recombinant Liriodendron tulipifera Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant psbA Protein

The psbA gene encodes the Photosystem II protein D1, a core component of PSII responsible for water oxidation and oxygen evolution. Recombinant psbA produced from L. tulipifera is a partial protein (344 amino acids) expressed in heterologous systems like baculovirus or mammalian cells . Key identifiers include:

ParameterDetails
Uniprot IDQ0G9N9
Gene NamepsbA
Protein LengthPartial (1-344 aa)
Molecular FunctionElectron transport in PSII; D1 photodamage repair
Expression SystemBaculovirus (default) or mammalian cells

Production and Purification

Recombinant psbA is produced using advanced expression systems and purified under stringent conditions:

ParameterDetails
Expression HostBaculovirus or mammalian cells
TagDetermined during manufacturing (commonly His-tag in related variants)
Reconstitution BufferTris-based buffer with 50% glycerol
Storage-20°C/-80°C (lyophilized: 12 months; liquid: 6 months)

Protocol Notes:

  • Lyophilized protein must be reconstituted in deionized sterile water (0.1–1.0 mg/mL) .

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Functional Role in Photosystem II

The psbA-encoded D1 protein is central to PSII repair under light stress:

  • Photodamage Response: Light-induced D1 degradation triggers ribosome recruitment to psbA mRNA, enabling rapid D1 replacement .

  • Electron Transport: Q(B) site in D1 mediates plastoquinone binding, critical for electron transfer from water to plastoquinone .

  • Autoregulation: D1 synthesis is coordinated with PSII assembly via a thylakoid membrane complex .

Research Applications

Recombinant psbA is utilized in:

  • ELISA and Immunoassays: Commercial kits (e.g., CSB-CF610020LGR) employ this protein for antibody validation .

  • Photosynthesis Studies: Used to investigate D1 turnover, photoinhibition, and PSII repair mechanisms .

  • Structural Biology: Provides material for crystallography and cryo-EM studies of PSII complexes .

Comparative Analysis with Homologs

The L. tulipifera psbA shares functional parallels with homologs in other species:

SpeciesUniprot IDKey Difference
Prorocentrum micansQ9TM72Full-length (343 aa), His-tagged, expressed in E. coli
L. tulipifera (psbT)Q7J188PSII-T subunit; co-expressed with psbA in repair cycles

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please include your desired format in the order notes and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please contact us in advance for arrangement and additional fees.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for your consideration.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Liriodendron tulipifera (Tuliptree) (Tulip poplar)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently utilized for ATP production. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Liriodendron tulipifera and why is its psbA protein significant for research?

Liriodendron tulipifera, commonly known as the tulip tree, American tulip tree, tulipwood, tulip poplar, whitewood, or yellow-poplar, is a deciduous tree native to eastern North America ranging from Southern Ontario to Illinois and south to central Florida and Louisiana . It is the tallest tree species in the eastern deciduous forest, capable of reaching heights over 50 meters (160 feet) . The psbA gene of L. tulipifera encodes the Photosystem Q(B) protein, also known as Photosystem II protein D1 or the 32 kDa thylakoid membrane protein .

The significance of studying this particular protein lies in the unique evolutionary position of L. tulipifera. As a member of the Magnoliaceae family, it represents an early-diverging lineage of flowering plants. This makes its photosynthetic proteins, including psbA, valuable for understanding the evolution of photosynthesis in angiosperms. Additionally, the L. tulipifera mitochondrial genome has evolved remarkably slowly, retaining genes frequently lost in other angiosperm lineages and demonstrating conservation of ancestral gene clusters . This evolutionary conservatism extends to its chloroplast genes, making the psbA protein a useful model for studying fundamental aspects of photosystem structure and function.

How is psbA expression regulated during photosystem biogenesis?

The expression of psbA is intricately regulated, particularly during the assembly of Photosystem II complexes. Research indicates that biogenesis of PSII involves a cascade of translational autoregulation mediated by unassembled subunits, including D1 (encoded by psbA) and CP47 .

The regulation occurs primarily at the translational level through a mechanism known as Control by Epistasy of Synthesis (CES). In this process, the 5' untranslated region (UTR) of the psbA mRNA plays a crucial role in translational control . When D1 protein fails to assemble properly into the PSII complex, it can bind to the 5' UTR of its own mRNA, inhibiting further translation. This autoregulatory mechanism ensures that D1 synthesis is coordinated with the availability of other PSII components and prevents the accumulation of unassembled proteins.

Interestingly, the recovery from photoinhibition—a process requiring rapid replacement of damaged D1 protein—appears to utilize a molecular mechanism distinct from the translational regulation that controls de novo synthesis of PSII cores . This suggests multiple layers of regulation controlling psbA expression depending on whether the context is new PSII assembly or repair of photodamaged complexes.

How does the evolutionary conservation of psbA in Liriodendron tulipifera compare to other angiosperms?

Liriodendron tulipifera represents a fascinating case of evolutionary conservation in the plant kingdom. The mitochondrial genome of L. tulipifera has evolved remarkably slowly in virtually all respects, showing an extraordinarily low genome-wide silent substitution rate and conservation of ancestral gene clusters .

While the search results don't provide direct comparative data for psbA specifically, they do mention that the mitochondrial protein genes in Liriodendron are the most heavily edited of any angiosperm characterized to date . Using Liriodendron as a phylogenetic reference point, researchers have estimated that the ancestral flowering plant mitochondrial genome contained 41 protein genes and more than 700 sites of RNA editing .

When comparing evolutionary rates across angiosperms, studies reveal an approximately 5,000-fold range of synonymous-site divergence among species whose mitochondrial genomes have been comprehensively sequenced . The Magnolia genome, another member of the Magnoliaceae family closely related to Liriodendron, has evolved at an even lower rate . This exceptional conservation in early-diverging lineages like Liriodendron makes its photosynthetic genes, including psbA, valuable references for understanding the ancestral state of these genes in flowering plants.

What molecular mechanisms link psbA expression to the assembly status of Photosystem II complexes?

The expression of psbA is tightly coupled to the assembly status of Photosystem II through a sophisticated regulatory mechanism. Research has demonstrated that biogenesis of PSII involves a cascade of translational autoregulation mediated by unassembled D1 and CP47 subunits .

This regulatory process follows the Control by Epistasy of Synthesis (CES) paradigm, where the synthesis of a given subunit is regulated by the assembly state of another subunit of the same complex. In the case of psbA (encoding D1), unassembled D1 protein acts as a negative regulator of its own translation. This autoregulation is mediated through specific interactions with the 5' untranslated region (UTR) of the psbA mRNA .

Experimentally, researchers have used reporter genes translated under the control of the 5' UTRs of CES genes like psbA or psbB to demonstrate this cascade of translational autoregulation . The mechanism ensures that the production of PSII subunits is coordinated with their assembly into functional complexes, preventing wasteful protein synthesis and potential toxicity from unassembled protein accumulation.

Importantly, this assembly-dependent regulation differs from the mechanism controlling D1 synthesis during recovery from photoinhibition . While both processes involve psbA translation, they appear to employ distinct molecular pathways, highlighting the complexity of photosynthetic protein regulation.

What is the role of psbA in photoinhibition and repair mechanisms of Photosystem II?

The D1 protein, encoded by psbA, is the primary target of photodamage during photosynthesis. High light intensity can lead to the formation of reactive oxygen species that damage the D1 protein, necessitating its removal and replacement in a process known as the PSII repair cycle.

Research indicates that the recovery from photoinhibition relies on molecular mechanisms distinct from the translational regulation controlling de novo synthesis of PSII cores . While both processes involve translation of the psbA mRNA, the regulatory mechanisms appear to differ significantly.

During normal PSII biogenesis, translation of psbA is regulated by the assembly status of the complex through interaction between unassembled D1 and its own mRNA's 5' UTR. In contrast, during repair after photoinhibition, translation of psbA must be rapidly upregulated regardless of assembly status to replace damaged D1 proteins.

This differentiation allows plants to maintain photosynthetic efficiency under varying light conditions by having dedicated mechanisms for both initial assembly and ongoing maintenance of photosystems.

What techniques are effective for expressing and purifying recombinant psbA protein?

Expression and purification of recombinant Photosystem Q(B) protein (psbA) from Liriodendron tulipifera requires specialized approaches due to its membrane-embedded nature and complex structure. Based on current methodologies for photosynthetic proteins, the following protocol is recommended:

  • Expression System Selection:

    • Bacterial systems (E. coli) with specialized membrane protein expression strains

    • Algal or plant-based expression systems that naturally contain thylakoid membranes

    • Cell-free expression systems supplemented with lipids or nanodiscs

  • Vector Design:

    • Include the full coding sequence (amino acids 1-344)

    • Add an affinity tag (His6, FLAG, or Strep-tag) for purification

    • Place the gene under control of an inducible promoter

    • Consider codon optimization for the expression host

  • Solubilization and Purification:

    • Extract using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Purify using affinity chromatography based on the chosen tag

    • Further purify by size exclusion chromatography if needed

    • Reconstitute into liposomes or nanodiscs for functional studies

The recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, with working aliquots kept at 4°C for up to one week .

How can researchers assess the functional integrity of recombinant psbA protein?

Verifying the functional integrity of recombinant Photosystem Q(B) protein is crucial before proceeding with experimental applications. Several complementary approaches can be employed:

  • Spectroscopic Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate chlorophyll binding and energy transfer

    • EPR spectroscopy to examine the manganese cluster and electron transport cofactors

  • Electron Transport Assays:

    • Oxygen evolution measurements using Clark-type electrodes

    • Artificial electron acceptor reduction (DCPIP or ferricyanide)

    • Flash-induced fluorescence decay kinetics to assess QA to QB electron transfer

  • Binding Assays:

    • Isothermal titration calorimetry for cofactor binding

    • Surface plasmon resonance for interaction with other PSII subunits

    • Fluorescence quenching for herbicide binding studies

  • Structural Verification:

    • Limited proteolysis to assess proper folding

    • Mass spectrometry for post-translational modifications

    • Single-particle cryo-EM if the protein is assembled in a complex

A comprehensive assessment should include comparing the recombinant protein's properties with those of native psbA isolated from Liriodendron tulipifera thylakoids. Functional assays should be performed under controlled temperature and light conditions, as these factors significantly affect D1 protein stability and activity.

What experimental designs are suitable for studying psbA-mediated translational regulation?

Investigating the translational regulation mechanisms of psbA requires specialized experimental approaches. Based on previous research , the following experimental designs are recommended:

  • Reporter Gene Constructs:

    • Fuse the 5' UTR of psbA to reporter genes (GFP, luciferase)

    • Create chimeric constructs with various segments of the 5' UTR to map regulatory elements

    • Use these constructs in transient expression or stable transformation experiments

  • In vitro Translation Systems:

    • Develop chloroplast extract-based translation systems

    • Add purified unassembled D1 protein to test direct translational repression

    • Use RNA electrophoretic mobility shift assays to detect protein-RNA interactions

  • Genetic Approaches:

    • Generate site-directed mutations in regulatory regions of the psbA 5' UTR

    • Create D1 protein variants unable to participate in autoregulation

    • Develop inducible expression systems to manipulate D1 levels temporally

  • Comparative Analysis:

    • Study psbA regulation during de novo synthesis versus photoinhibition recovery

    • Compare regulatory mechanisms across different plant species

    • Examine regulation under various environmental stresses

Experimental ConditionDe Novo PSII SynthesisPhotoinhibition Recovery
Translation RegulationAssembly-dependentAssembly-independent
Key RegulatorsUnassembled D1 proteinLight-responsive factors
5' UTR InvolvementHighModerate
Response TimeSlow (hours)Rapid (minutes)
Energy RequirementLowerHigher

These experimental designs can help elucidate the distinct molecular mechanisms controlling psbA translation during normal PSII biogenesis versus repair after photodamage, as indicated by previous research .

What approaches can be used to study the evolutionary significance of psbA in Liriodendron tulipifera?

Investigating the evolutionary significance of the psbA gene in Liriodendron tulipifera requires integrating molecular, phylogenetic, and functional approaches:

  • Comparative Genomics:

    • Sequence psbA from diverse angiosperms, including basal lineages

    • Calculate substitution rates to identify conserved functional domains

    • Map selection pressures across different regions of the gene

  • Phylogenetic Analysis:

    • Construct gene trees based on psbA sequences

    • Compare with species trees to identify potential horizontal gene transfer events

    • Analyze coevolution with other photosynthetic genes

  • Population Genetics:

    • Sample psbA sequences from Liriodendron populations across its range

    • Examine gene flow patterns, particularly between mainland and peninsular Florida populations

    • Identify signatures of selection or genetic drift

  • Functional Evolutionary Studies:

    • Express ancestral reconstructed psbA sequences

    • Test functional properties of psbA variants found in different populations

    • Examine the biochemical consequences of naturally occurring mutations

The evolutionary analysis of psbA is particularly interesting in light of the reduced gene flow from mainland populations of Liriodendron tulipifera into the Florida peninsula, which promotes diversification . Research has shown that the Florida peninsula has served as an important refugium for plant populations during glacial cycles, with its unique geologic history creating environments that differ from nearby mainland sites . This geographic isolation may have contributed to genetic divergence in genes like psbA, potentially leading to local adaptations in photosynthetic function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.