Recombinant Listeria innocua serovar 6a Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls; lin2646; Cardiolipin synthase; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
cls
Target Protein Sequence
MGLLAYLLVILLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDPNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDVGYIGGFNI GDEYLGRSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTHKIDYKARYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: lin:lin2646

STRING: 272626.lin2646

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase in Listeria innocua and what is its functional significance?

Cardiolipin synthase (cls) in Listeria innocua serovar 6a is an essential enzyme responsible for the biosynthesis of cardiolipin, a key phospholipid component of bacterial membranes. The full-length protein consists of 482 amino acids (1-482aa) and plays a critical role in membrane structure and function . Cardiolipin is particularly enriched in bacterial membrane domains associated with cell division, energy metabolism, and osmotic stress response.

The enzyme catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol. This reaction is crucial for maintaining proper membrane architecture and fluidity, especially under stress conditions. The protein contains multiple transmembrane domains, as evidenced by its hydrophobic N-terminal region in the amino acid sequence, suggesting its localization within the bacterial membrane .

Unlike its pathogenic relative Listeria monocytogenes, Listeria innocua is non-pathogenic, making its proteins potentially safer alternatives for research applications while maintaining similar enzymatic functions and structural properties to their pathogenic counterparts.

How does the amino acid sequence inform our understanding of Listeria innocua cardiolipin synthase structure and function?

The amino acid sequence of Listeria innocua serovar 6a Cardiolipin synthase (UniProt ID: Q927Z0) provides substantial insights into its structural organization and functional domains . Analysis of the sequence reveals:

  • N-terminal hydrophobic region: The sequence "MGLLAYLLVILLILNVFFAAVTVFLER" indicates multiple transmembrane helices, confirming its membrane-embedded nature.

  • Catalytic domain: The middle portion of the sequence contains the catalytic machinery required for the condensation reaction.

  • Substrate binding sites: Several conserved motifs within the sequence are predicted to be involved in recognition and binding of phosphatidylglycerol substrates.

The complete amino acid sequence also enables structural prediction through homology modeling with related enzymes, allowing researchers to identify potential active site residues for targeted mutagenesis studies. Comparative sequence analysis with cardiolipin synthases from other bacterial species can reveal conserved regions essential for function versus species-specific adaptations .

What are the optimal storage and reconstitution protocols for recombinant Listeria innocua Cardiolipin synthase?

For optimal stability and activity of recombinant Listeria innocua serovar 6a Cardiolipin synthase, storage and reconstitution must be carefully controlled:

Storage recommendations:

  • Long-term storage: Maintain at -20°C or -80°C in aliquots to prevent freeze-thaw cycles

  • Short-term use: Working aliquots can be stored at 4°C for up to one week

  • Buffer composition: The protein should be stored in either Tris/PBS-based buffer with 6% trehalose (pH 8.0) or Tris-based buffer with 50% glycerol

Reconstitution protocol:

  • Centrifuge the vial briefly before opening to collect contents at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term stability, add glycerol to a final concentration of 5-50%

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • For membrane protein studies, consider incorporating mild detergents to maintain protein solubility

Repeated freeze-thaw cycles significantly reduce enzymatic activity and should be strictly avoided. Activity assays should be performed immediately after reconstitution to establish baseline activity levels .

What expression systems are most effective for producing functional recombinant Cardiolipin synthase?

Expression system optimization:

  • Vector selection: Vectors with inducible promoters (e.g., T7) allow controlled expression

  • Fusion tags: N-terminal His-tags facilitate purification while maintaining enzymatic activity

  • E. coli strains: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

  • Growth conditions: Lower temperatures (16-20°C) after induction can improve proper folding

  • Induction parameters: IPTG concentration and induction timing require optimization

Potential challenges and solutions:

  • Membrane protein toxicity: Use tight promoter control and lower expression temperatures

  • Inclusion body formation: Optimize solubilization conditions with mild detergents

  • Low yields: Consider codon optimization for the E. coli expression system

The resulting recombinant protein should undergo rigorous quality control testing, including SDS-PAGE analysis (>90% purity) , mass spectrometry verification, and activity assays to confirm functional integrity before experimental use.

How does Listeria innocua Cardiolipin synthase compare to similar enzymes in pathogenic Listeria species?

Cardiolipin synthase from Listeria innocua serovar 6a represents an important model for comparative studies with enzymes from pathogenic Listeria species, particularly Listeria monocytogenes:

Structural comparisons:

  • High sequence homology exists between cardiolipin synthases from Listeria innocua and Listeria monocytogenes

  • Both possess similar domain organization and catalytic mechanisms

  • Species-specific variations may confer subtle differences in substrate specificity or activity regulation

Functional differences:

  • Cardiolipin composition affects membrane rigidity and permeability

  • These differences may contribute to the non-pathogenic nature of L. innocua compared to pathogenic Listeria species

  • Differential expression and regulation under stress conditions may exist between species

Research advantages:

  • L. innocua provides a biosafe alternative for studying essential Listeria membrane enzymes

  • The recombinant protein allows investigation of enzymatic mechanisms without pathogenicity concerns

  • Comparative studies can identify potential targets for antimicrobial development

This comparative approach is particularly valuable in understanding how membrane composition contributes to bacterial pathogenicity, stress responses, and environmental adaptation across Listeria species .

What experimental approaches are recommended for investigating the role of Cardiolipin synthase in bacterial membrane dynamics?

Several experimental approaches can effectively investigate the role of Cardiolipin synthase in bacterial membrane dynamics:

Biochemical and biophysical techniques:

  • Lipidomic analysis: Quantitative mass spectrometry to profile membrane lipid composition changes

  • Fluorescence microscopy: Using cardiolipin-specific dyes (e.g., 10-N-nonyl acridine orange) to visualize cardiolipin-rich domains

  • Differential scanning calorimetry: To measure the effects of cardiolipin on membrane phase transitions and fluidity

  • Atomic force microscopy: For direct visualization of membrane domain organization

Genetic and molecular approaches:

  • Controlled expression systems: Using inducible promoters to regulate cls expression levels

  • Site-directed mutagenesis: Targeting conserved residues to examine their role in enzymatic function

  • Reporter gene fusions: To monitor cls expression under various growth conditions

  • Gene replacement studies: Comparing wild-type with modified strains, similar to the approach used with Listeria ivanovii

Functional assays:

  • Membrane permeability assays: Measuring the effect of cardiolipin levels on membrane integrity

  • Stress response measurement: Testing bacterial survival under osmotic, pH, or temperature stress

  • Enzyme activity assays: Monitoring phospholipid conversion rates in various membrane compositions

These approaches provide complementary insights into how Cardiolipin synthase influences membrane organization, stress adaptation, and cell division in Listeria innocua and related bacteria.

What methodologies are recommended for elucidating the catalytic mechanism of Listeria innocua Cardiolipin synthase?

Elucidating the catalytic mechanism of Listeria innocua Cardiolipin synthase requires multiple complementary approaches:

Structural determination:

  • X-ray crystallography: The greatest challenge is obtaining crystals of this membrane protein. Strategies include:

    • Using lipidic cubic phase crystallization

    • Creating fusion constructs with crystallization chaperones

    • Limited proteolysis to identify stable domains

  • Cryo-electron microscopy: Increasingly valuable for membrane proteins that resist crystallization

    • Requires preparation of homogeneous protein-detergent complexes

    • May provide insights into conformational changes during catalysis

Mechanistic investigations:

  • Enzyme kinetics: Determining reaction rates with varying substrate concentrations

  • Isotope labeling experiments: Using 32P-labeled phospholipids to track phosphate transfer reactions

  • Site-directed mutagenesis: Systematically altering potential catalytic residues identified from the sequence (based on the Q927Z0 UniProt entry)

  • Spectroscopic methods: Fluorescence and circular dichroism to monitor protein-substrate interactions

Computational approaches:

  • Molecular dynamics simulations: To model enzyme-substrate interactions within the membrane environment

  • Quantum mechanics/molecular mechanics (QM/MM): For detailed modeling of the transition state of the condensation reaction

  • Sequence-based phylogenetic analysis: Comparing catalytic residues across bacterial cardiolipin synthases

These methodologies, when combined, provide a comprehensive understanding of the catalytic mechanism and structure-function relationships of this important membrane enzyme.

How can researchers investigate the effect of Cardiolipin synthase modifications on bacterial physiology?

Investigating the effects of Cardiolipin synthase modifications on bacterial physiology requires systematic approaches that bridge molecular and cellular analyses:

Genetic modification strategies:

  • Gene replacement: Substituting native cls with modified variants (similar to ilo/hly replacements in Listeria species)

  • Inducible expression systems: Creating strains with titratable cls expression

  • Point mutations: Introducing specific amino acid changes to alter activity without completely abolishing function

  • Domain swapping: Exchanging domains between cardiolipin synthases from different species

Physiological assessment methods:

  • Growth curve analysis: Under standard and stress conditions (temperature, pH, osmotic pressure)

  • Membrane integrity assays: Using membrane-impermeant dyes to assess permeability changes

  • Microscopy techniques: To observe cell morphology, division defects, and protein localization

  • Lipid composition analysis: Quantitative lipidomics to measure actual changes in membrane phospholipid profiles

Complex phenotype analysis:

Assessment ParameterMeasurement TechniqueExpected Outcome with Modified cls
Growth rateSpectrophotometric monitoringChanges in doubling time
Stress toleranceSurvival after challengeAltered resistance profile
Membrane fluidityFluorescence anisotropyModified phase transition temperatures
Protein localizationFluorescence microscopyRedistribution of membrane proteins
Cell divisionTime-lapse microscopyDivision defects or altered morphology

The approach used with Listeria ivanovii gene replacement studies provides an excellent methodological template, where immune responses and bacterial clearance were systematically measured after genetic modifications .

How can researchers verify the activity and integrity of recombinant Listeria innocua Cardiolipin synthase?

Verifying the activity and integrity of recombinant Listeria innocua Cardiolipin synthase requires multiple quality control steps:

Protein integrity assessment:

  • SDS-PAGE analysis: Should show >90% purity with a single band at ~53 kDa (482 amino acids plus His-tag)

  • Western blotting: Using anti-His antibodies to confirm the presence of the tagged protein

  • Mass spectrometry: To verify the correct molecular weight and sequence coverage

  • Circular dichroism: To confirm proper secondary structure, particularly important for membrane proteins

Activity verification:

  • Radiometric assays: Using 14C-labeled phosphatidylglycerol as substrate and thin-layer chromatography to separate products

  • Fluorescence-based assays: With fluorescent phospholipid analogs to monitor condensation reaction

  • Coupled enzyme assays: Measuring glycerol release as a reaction product

  • Reconstitution into liposomes: Testing activity in a membrane-like environment

Stability monitoring:

  • Thermal shift assays: To assess protein stability under different buffer conditions

  • Time-course activity measurements: Testing enzyme retention of activity after various storage periods

  • Size-exclusion chromatography: To detect aggregation or degradation products

Researchers should establish baseline activity immediately after purification and reconstitution, and maintain reference aliquots for comparative testing throughout a research project .

What are common challenges when working with recombinant membrane proteins like Cardiolipin synthase and how can they be addressed?

Recombinant membrane proteins like Cardiolipin synthase present several unique challenges that require specific strategies:

Solubility and aggregation issues:

  • Challenge: Poor solubility and tendency to aggregate
    Solution: Optimize detergent type and concentration; screen detergent mixtures; consider adding lipids during purification

  • Challenge: Formation of inclusion bodies during expression
    Solution: Lower expression temperature (16-20°C); use specialized E. coli strains; optimize induction conditions

Activity and stability concerns:

  • Challenge: Loss of activity during purification
    Solution: Minimize time between cell disruption and purification; include protease inhibitors; maintain consistent cold temperature

  • Challenge: Determining true enzymatic activity
    Solution: Develop robust activity assays that account for substrate accessibility in detergent micelles or liposomes

Structural integrity:

  • Challenge: Ensuring proper folding in non-native environments
    Solution: Validate secondary structure using circular dichroism; compare activity to native membrane preparations

  • Challenge: Maintaining stability during storage
    Solution: Store in 50% glycerol at -80°C in small aliquots; avoid repeated freeze-thaw cycles

Experimental recommendations:

  • Begin with small-scale expression tests to optimize conditions before scaling up

  • Consider nanodiscs or amphipols as alternatives to detergents for stabilizing membrane proteins

  • Validate functionality through complementation studies in bacterial strains with cls deletions

  • Include proper controls in all experiments to account for detergent or buffer effects on assay systems

Following these approaches can significantly improve the likelihood of obtaining functionally active recombinant Cardiolipin synthase for research applications.

What emerging technologies are advancing the study of bacterial Cardiolipin synthases?

The study of bacterial Cardiolipin synthases, including from Listeria innocua, is being revolutionized by several emerging technologies:

Advanced structural biology approaches:

  • Cryo-electron tomography: Allowing visualization of Cardiolipin synthase in its native membrane environment

  • Micro-electron diffraction (MicroED): Enabling structure determination from nanocrystals of membrane proteins

  • Integrative structural biology: Combining multiple data sources (NMR, SAXS, cross-linking) for comprehensive structural models

Genetic and genomic technologies:

  • CRISPR-Cas9 genome editing: For precise modification of cls genes and regulatory elements

  • Single-cell transcriptomics: To understand cls expression heterogeneity within bacterial populations

  • Transposon sequencing (Tn-seq): For high-throughput identification of genetic interactions with cls

Biophysical innovations:

  • High-speed atomic force microscopy: For real-time visualization of membrane dynamics

  • Super-resolution microscopy: To track Cardiolipin synthase localization with nanometer precision

  • Native mass spectrometry: For studying protein-lipid interactions in near-native states

These technologies offer unprecedented opportunities to understand Cardiolipin synthase function in the context of bacterial physiology, membrane organization, and stress responses, potentially opening new avenues for antimicrobial development targeting membrane biosynthesis pathways.

How might research on Listeria innocua Cardiolipin synthase contribute to biotechnological applications?

Research on Listeria innocua Cardiolipin synthase has significant potential for biotechnological applications:

Vaccine development platforms:

  • Attenuated bacterial vectors: L. innocua as a safer alternative to pathogenic Listeria for vaccine delivery, with cls modifications potentially enhancing immunogenicity

  • Adjuvant development: Cardiolipin-containing liposomes as potential immune stimulators

  • Bacterial ghost technology: Using cls-modified bacterial membranes as antigen delivery systems

Enzyme engineering applications:

  • Biocatalysis: Engineered cardiolipin synthases for industrial production of specialized phospholipids

  • Biosensor development: Using cls activity as reporters in membrane-based biosensors

  • Synthetic biology: Incorporation into artificial cell systems with customized membrane properties

Pharmaceutical applications:

  • Antimicrobial development: Targeting cardiolipin biosynthesis as a novel approach to antimicrobial therapy

  • Drug delivery systems: Cardiolipin-enriched liposomes for targeted drug delivery

  • Membrane protein production: Improved systems for expressing other challenging membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.