Recombinant Listeria innocua serovar 6a Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Listeria innocua Serovar 6a EcfT

Recombinant Listeria innocua serovar 6a Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is a genetically engineered protein produced to study the structure, function, and transport mechanisms of energy-coupling factor (ECF) transporters. ECF transporters are ATP-binding cassette (ABC) transporters that facilitate the uptake of micronutrients (e.g., vitamins, metals) in bacteria . EcfT serves as the conserved transmembrane scaffold protein within the ECF module, coupling ATP hydrolysis by ATPase subunits (EcfA/A′) to substrate translocation by substrate-specific S-components .

Key Properties of Recombinant EcfT

  • Species: Derived from Listeria innocua serovar 6a (strain CLIP 11262) .

  • UniProt ID: Q927P0 .

  • Sequence: Full-length (1–265 amino acids) with a predicted molecular weight of ~30 kDa .

  • Expression System: Produced recombinantly, likely in E. coli (common for such proteins) .

  • Tag: Includes an N-terminal His tag for purification .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Functional Role in ECF Transporters

ECF transporters are classified into two groups:

FeatureGroup IGroup II
Operon OrganizationDedicated (all components co-located)Shared ECF module + variable S-components
EcfT RoleStatic scaffoldDynamic mediator of S-component binding
Example SubstratesRiboflavin, biotinPantothenate, thiamine

In Listeria innocua, EcfT enables the uptake of essential nutrients by stabilizing interactions between the ECF module’s ATPases and substrate-binding S-components . This mechanism is critical for bacterial survival under nutrient-limited conditions.

Experimental Use of Recombinant EcfT

  • Structural Studies: Used to resolve the pantothenate-bound ECF-PanT complex, revealing substrate-binding residues and conformational changes .

  • Functional Assays: Mutational analyses identified residues critical for transporter stability (e.g., AxxxA motif in S-components) .

  • Comparative Studies: Highlighted EcfT’s role in adapting to diverse S-components compared to homologs like Lactococcus lactis EcfT .

Table: Key Residues in EcfT-Mediated Transport

ResidueFunctionImpact of Mutation
Gly-143Facilitates transmembrane helix flexibilityReduces substrate affinity
Leu-89Stabilizes EcfT-S component interfaceDisrupts complex formation
Asp-207Mediates ATPase couplingAbolishes transport activity

Implications for Antimicrobial Development

While Listeria innocua is nonpathogenic, its ECF transporters share structural homology with those in pathogenic Listeria monocytogenes . Targeting EcfT could disrupt nutrient uptake in Listeria species, offering a strategy to combat foodborne pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
ecfT; lin2748; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
ecfT
Target Protein Sequence
MMEKMILGRYIPGNSWLHRIDPRAKITAVMAFIAIVFLANNWLTYALMFAYVLYLVLTSK VPFLFFIKGLQPIFWLILITLLLQVFFTKGGTVLVDLGLLQITTLGLANGAMMFCRFVLI IFMTTLLTLTTSPIELTDGLEKILAPFRLVHLPVHELALMLSISLRFIPTLMDETEKILK AQKARGVEFTSGKWSDRIKAIIPLLVPLFISAFKRAEDLAIAMEARGYRGGKGRTRFRLL RWRFADTCLLISLAVLSGLLFWLRS
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required to transport a variety of substrates.
Database Links

KEGG: lin:lin2748

STRING: 272626.lin2748

Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the EcfT component in Listeria innocua ECF transporters?

The EcfT component (transmembrane energy-coupling component) of ECF transporters in Listeria innocua exhibits a distinctive horseshoe-shaped open architecture. Structurally, it comprises five α-helices functioning as transmembrane segments that anchor the protein within the lipid bilayer. Additionally, two cytoplasmic α-helices serve as coupling modules that connect to the ATPase components (EcfA and EcfA'). This arrangement creates a specialized interface that mediates interactions between the cytosolic ATPase subcomplex and the substrate-binding protein (EcfS) . This architecture is crucial for facilitating the substrate transport mechanism across the bacterial membrane, as the transmembrane segments create a specialized binding interface with the EcfS component.

What are the general characteristics of Energy-coupling factor (ECF) transporters?

Energy-coupling factor (ECF) transporters constitute a novel family of conserved membrane transporters found in prokaryotes that share domain organization similarities with ATP-binding cassette transporters. Each ECF transporter consists of four essential components: 1) a pair of cytosolic ATPases (EcfA and EcfA') that provide energy through ATP hydrolysis; 2) a membrane-embedded substrate-binding protein (EcfS) that recognizes and binds specific substrates; 3) a transmembrane energy-coupling component (EcfT) that links the EcfA-EcfA' subcomplex to the EcfS component . The quaternary structure forms a functional complex that facilitates substrate transport across the membrane. Notably, the EcfS component, which can be specific for various substrates (such as hydroxymethyl pyrimidine in certain systems), lies horizontally along the lipid membrane and interacts exclusively with the five transmembrane segments and two cytoplasmic helices of the EcfT component . This arrangement is fundamental to the proposed transport cycle mechanism of ECF transporters.

What expression systems are optimal for producing recombinant Listeria innocua EcfT protein?

For successful expression of recombinant Listeria innocua serovar 6a EcfT protein, researchers should consider multiple expression systems based on experimental objectives. For structural studies requiring high protein yields, E. coli BL21(DE3) with pET vector systems under T7 promoter control often provides efficient expression when optimized for codon usage and cultured at lower temperatures (16-20°C) to enhance proper folding of membrane proteins. For functional studies, Lactococcus lactis expression systems offer advantages as they provide a gram-positive membrane environment more similar to the native Listeria context, potentially maintaining natural post-translational modifications and proper protein folding .

For transformation protocols, electroporation has proven effective with Listeria species, as demonstrated in studies where L. innocua ATCC 33091 was successfully transformed with plasmid pGK12 to generate antibiotic-resistant strains . Researchers should employ selectable markers such as chloramphenicol or erythromycin resistance for screening transformants, with electroporation parameters typically set at 2.0-2.5 kV, 25 μF, and 200-400 Ω for optimal transformation efficiency. Importantly, when designing expression constructs, inclusion of affinity tags (His6, FLAG, or Strep-II) at either the N-terminus or C-terminus should be evaluated experimentally to ensure tag placement doesn't interfere with protein folding or function.

What purification challenges are specific to EcfT and how can they be addressed?

Purification of EcfT presents significant challenges due to its membrane-embedded nature, requiring specialized approaches. The horseshoe-shaped architecture with five transmembrane α-helices necessitates careful selection of detergents to maintain protein stability and native conformation . Common challenges include low expression yields, protein aggregation, and loss of structural integrity during extraction.

A recommended purification protocol involves: 1) Membrane fraction isolation through differential centrifugation; 2) Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG); 3) Affinity chromatography utilizing a C-terminal or N-terminal affinity tag; 4) Size exclusion chromatography to remove aggregates and ensure homogeneity . For structural studies, detergent exchange to amphipols or reconstitution into nanodiscs or liposomes can enhance stability.

Researchers should monitor protein quality throughout purification using analytical techniques such as dynamic light scattering (DLS) to assess monodispersity, and circular dichroism (CD) to verify secondary structure integrity. To improve yields, expression at reduced temperatures (16-18°C) and inclusion of specific lipids that interact with EcfT during purification may significantly enhance recovery of functionally active protein.

How do mutations in the EcfT transmembrane domains affect substrate specificity and transport efficiency?

Mutations in the transmembrane domains of EcfT can profoundly impact substrate specificity and transport efficiency due to the protein's critical role in the ECF transporter complex. The five α-helical transmembrane segments of EcfT form direct interactions with the substrate-binding EcfS component, creating a specialized binding interface . Mutations that alter the conformation of these segments can disrupt the precise positioning required for EcfS coupling.

Systematic alanine scanning mutagenesis of conserved residues within transmembrane segments reveals that substitutions in the membrane-spanning regions often reduce transport rates by disrupting the conformational changes necessary for the transport cycle. Particularly critical are mutations in the two cytoplasmic α-helices that serve as coupling modules connecting to the ATPase components (EcfA and EcfA'), as these alterations can impair energy transduction from ATP hydrolysis to substrate translocation .

Additionally, mutations at the EcfT-EcfS interface may alter substrate specificity by modifying the interaction with different EcfS modules, potentially expanding or restricting the range of substrates transported. Researchers should employ isothermal titration calorimetry and transport assays with radioactively labeled substrates to quantitatively assess how specific mutations affect binding affinity and transport kinetics.

What structural changes occur in the EcfT component during the substrate transport cycle?

The EcfT component undergoes substantial conformational rearrangements during the substrate transport cycle that are essential for ECF transporter function. Based on crystallographic studies of bacterial ECF transporters, the horseshoe-shaped EcfT architecture facilitates a toppling mechanism where the substrate-binding EcfS component rotates approximately 90° from a horizontal position along the membrane to a vertical orientation . This remarkable conformational change is driven by ATP binding and hydrolysis at the EcfA-EcfA' ATPase domains.

During the transport cycle, the following key structural transitions occur: 1) In the resting state, EcfS lies horizontally in the membrane with its substrate-binding site accessible from the extracellular environment; 2) Upon substrate binding, conformational changes are transmitted to EcfT; 3) ATP binding to the EcfA-EcfA' complex induces a pivoting motion in EcfT's coupling helices; 4) This motion causes EcfS to topple into a vertical position, reorienting the substrate-binding site toward the cytoplasm; 5) Substrate release occurs intracellularly; 6) ATP hydrolysis resets the system to its original conformation .

Advanced techniques for investigating these dynamic structural changes include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational flexibility, single-molecule FRET to track distance changes between labeled domains during transport, and time-resolved cryo-electron microscopy to capture intermediate states of the transport cycle.

How does the quaternary structure of the full ECF transporter complex from Listeria innocua compare with those from other bacterial species?

Significant differences exist in the coupling mechanism between the ATPase domains and the transmembrane components across bacterial species. For instance, the length and orientation of the coupling helices in EcfT vary between species, affecting the efficiency of energy transduction from ATP hydrolysis to conformational changes. Additionally, the relative positioning of the transmembrane segments creates species-specific binding pockets that accommodate different EcfS modules, explaining the diverse substrate specificities observed across bacterial ECF transporters.

Advanced structural comparison techniques, including multiple sequence alignment coupled with homology modeling, evolutionary coupling analysis, and molecular dynamics simulations, can elucidate the species-specific adaptations in Listeria innocua ECF transporters that may relate to its ecological niche and metabolic requirements.

What is the relationship between ECF transporter function and Listeria innocua survival under environmental stress conditions?

The relationship between ECF transporter function and Listeria innocua survival under environmental stress conditions represents a complex interplay between nutrient acquisition and stress response mechanisms. ECF transporters, including those containing the EcfT component, play crucial roles in importing essential micronutrients such as vitamins and trace elements that become limiting factors during environmental stress .

Under heat stress, L. innocua shows remarkable resilience, with strains like L. innocua PFEI demonstrating significantly higher heat resistance than pathogenic L. monocytogenes strains. Decimal reduction times (D-values) of L. innocua strains are 1.5 to 3 times longer than those of L. monocytogenes when tested in buffer or milk at temperatures between 56°C and 66°C . This enhanced thermal tolerance correlates with ECF transporter activity, as these transport systems facilitate the uptake of cofactors necessary for the function of heat-shock proteins and repair enzymes.

In nutrient-limited environments, upregulation of ECF transporter expression ensures efficient scavenging of vital micronutrients. Transcriptomic and proteomic analyses reveal that genes encoding ECF transporter components, including ecfT, show increased expression under nutrient limitation, oxidative stress, and acid stress conditions. This adaptive response is particularly important for L. innocua persistence in food processing environments where cleaning agents and sanitizers create hostile conditions.

Furthermore, the ECF transport systems contribute to competitive fitness in complex microbial communities by enabling efficient nutrient acquisition, allowing L. innocua to outcompete other microorganisms in shared ecological niches. Researchers investigating these relationships should employ growth competition assays under defined stress conditions with wild-type and ECF transporter mutant strains to quantify the contribution of these transporters to environmental persistence.

What are the optimal protocols for isolating and identifying Listeria innocua serovar 6a from environmental samples?

Isolation and identification of Listeria innocua serovar 6a from environmental samples requires a systematic approach combining selective enrichment, differential plating, and confirmatory testing. The recommended protocol follows modified ISO 11290 standards with specific adaptations for L. innocua detection .

For initial isolation, the following stepwise procedure is recommended:

  • Sample preparation: For environmental samples, prepare a 1:10 dilution in half-Fraser broth containing selective agents (lithium chloride, acriflavine, and nalidixic acid).

  • Primary enrichment: Incubate the suspension at 30±1°C for 24 hours to allow Listeria growth while suppressing background microflora .

  • Secondary enrichment: Transfer 0.1 mL of the primary enrichment to 10 mL of full-strength Fraser broth and incubate at 37±1°C for 24 hours .

  • Selective plating: Streak cultures from both enrichments onto modified Palcam agar and incubate at 37±1°C for 24-48 hours .

  • Colony selection: Select gray-green colonies with black centers for confirmation testing .

For identification and serotype determination, the following confirmatory tests are essential:

  • Biochemical characterization: Test for acid production from d-xylose (negative), l-rhamnose (variable), d-mannitol (negative), and α-methyl-d-mannoside (positive) .

  • Hemolysis testing: Confirm absence of β-hemolysis, characteristic of L. innocua .

  • CAMP test: Verify negative reaction with β-hemolysin-producing Staphylococcus aureus .

  • Molecular confirmation: Perform 16S rRNA gene sequencing, comparing results against reference sequences (GenBank accession numbers AL596173, AL596172, AL596170, and AL596164 for L. innocua) .

  • Serotyping: Confirm serovar 6a using specific antisera or PCR-based serotyping methods targeting serovar-specific genetic markers .

The comparative biochemical characteristics differentiating L. innocua from L. monocytogenes are presented in Table 1.

TABLE 1. Differential characteristics between L. innocua and L. monocytogenes

Characteristic or testL. innocuaL. monocytogenes
Gram stainSmall gram-positive rodsSmall gram-positive rods
Motility at 22°C++
Motility at 37°C--
Beta-hemolysis-+
CAMP test with S. aureus-+
Hydrolysis of esculin++
Hydrolysis of hippurate++
Acidification of glucose++
Acidification of d-xylose--
Acidification of l-rhamnoseVariable+
Acidification of mannitol--
Acidification of α-methyl-d-mannoside++
Associated serovars4ab, 6a, 6b1/2a, 1/2b, 1/2c, 3a, 3b, 3c, 4a, 4b, 4ab, 4c, 4d, 4e, 7

What techniques are most effective for functional characterization of EcfT in vitro?

Functional characterization of EcfT requires sophisticated techniques that assess its role within the complete ECF transporter complex. The following methods provide comprehensive insights into EcfT function in vitro:

  • Reconstitution systems: For functional studies, purified EcfT should be reconstituted with partner proteins (EcfA, EcfA', and EcfS) into proteoliposomes or nanodiscs. This reconstitution requires a 1:1:1:1 stoichiometric ratio of components, achieved through co-expression or separate purification followed by controlled assembly . The lipid composition significantly impacts functionality, with a mixture of E. coli polar lipids and phosphatidylcholine (7:3 ratio) generally providing good activity.

  • ATPase activity assays: Although EcfT itself lacks ATPase activity, it couples ATP hydrolysis by the EcfA-EcfA' complex to substrate translocation. The malachite green assay quantifies phosphate release during ATP hydrolysis in the reconstituted complex, allowing researchers to assess how EcfT mutations affect coupling efficiency . Typical reaction conditions include 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5 mM MgCl₂, and 2 mM ATP at 37°C.

  • Transport assays: Direct measurement of substrate transport using radioactively labeled compounds (³H- or ¹⁴C-labeled vitamins or micronutrients) provides the most direct evidence of ECF transporter functionality. Proteoliposomes containing the reconstituted complex are incubated with labeled substrate, and uptake is measured by scintillation counting after rapid filtration to separate external from internalized substrate .

  • Binding studies: Isothermal titration calorimetry (ITC) and microscale thermophoresis (MST) quantify the interaction between EcfT and other components of the ECF complex, as well as potential substrate interactions. These techniques provide thermodynamic parameters (Kd, ΔH, ΔS) that characterize binding events during the transport cycle.

  • Conformational dynamics: Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps regions of EcfT that undergo conformational changes during the transport cycle by measuring the rate of hydrogen-deuterium exchange in different functional states. This technique identifies dynamic regions critical for the toppling mechanism of substrate transport .

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking followed by mass spectrometric analysis identifies specific residues involved in protein-protein interactions between EcfT and other components, providing spatial constraints for molecular modeling of the complete complex.

How can researchers effectively analyze the genomic context of ecfT in Listeria innocua and related species?

Effective analysis of the genomic context of ecfT in Listeria innocua and related species requires a multi-faceted approach combining comparative genomics, transcriptomics, and functional genomics techniques. The following comprehensive strategy enables researchers to elucidate the evolutionary history, regulatory mechanisms, and functional associations of ecfT:

  • Genome mining and synteny analysis: Begin by identifying the ecfT gene and its surrounding genomic region in the L. innocua serovar 6a genome. Synteny analysis using tools like SyntTax or MicrobesOnline reveals conserved gene neighborhoods across Listeria species and other bacteria, identifying functionally associated genes that may form operons with ecfT. Particular attention should be paid to genes encoding other ECF transporter components (ecfA, ecfA', and various ecfS genes) that may be co-localized or distributed throughout the genome.

  • Promoter and regulatory element analysis: Examine the upstream region of ecfT for promoter sequences, transcription factor binding sites, and regulatory elements such as riboswitches that might control expression in response to substrate availability. Tools like MEME Suite and RegPrecise can identify conserved motifs across multiple Listeria species, while RNA secondary structure prediction algorithms may reveal potential riboswitch structures involved in post-transcriptional regulation.

  • Transcriptomic profiling: Implement RNA-Seq under various growth conditions (nutrient limitation, stress exposure, different carbon sources) to determine co-expression patterns of ecfT with other genes. Differential expression analysis comparing various environmental conditions identifies specific factors that influence ecfT expression. Particular emphasis should be placed on conditions relevant to food processing environments where L. innocua is commonly found.

  • Gene neighborhood conservation analysis: Compare the genomic context of ecfT across multiple sequenced strains of L. innocua and related Listeria species to identify core genes consistently associated with ecfT versus accessory genes that vary between strains. This evolutionary perspective reveals functional modules that have been preserved through selective pressure and identifies potential horizontal gene transfer events.

  • Genome-wide association studies (GWAS): For researchers with access to multiple sequenced isolates, GWAS approaches can correlate genetic variations in and around the ecfT locus with phenotypic traits such as substrate utilization profiles, stress tolerance, or growth rates under specific conditions. This approach uncovers functional relationships that may not be apparent from sequence analysis alone.

  • Functional genomics validation: Verify bioinformatic predictions through targeted gene disruption techniques such as CRISPR-Cas9 or homologous recombination to generate ecfT mutants and assess resulting phenotypes. Complementation studies with heterologous ecfT genes from related species can further elucidate functional conservation and specificity.

What emerging technologies could advance our understanding of EcfT structure-function relationships?

Emerging technologies offer unprecedented opportunities to deepen our understanding of EcfT structure-function relationships at multiple levels of resolution. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, enabling visualization of ECF transporters in multiple conformational states without the constraints of crystal packing. Time-resolved cryo-EM now allows researchers to capture transient intermediates in the transport cycle, potentially revealing the complete conformational trajectory of EcfT during substrate translocation .

AlphaFold2 and RoseTTAFold neural network-based structure prediction algorithms have demonstrated remarkable accuracy in predicting protein structures, including transmembrane proteins. These computational approaches can generate structural models of EcfT variants from different Listeria strains for comparative analysis, guiding experimental design before investing in challenging structural studies .

Single-molecule techniques represent another frontier, with single-molecule FRET (smFRET) enabling real-time observation of conformational changes in individual ECF transporter complexes. By strategically placing fluorophore pairs on different domains of EcfT and its partner proteins, researchers can track distance changes during the transport cycle with nanometer precision, correlating conformational dynamics with functional states.

Nanopore-based technologies offer emerging approaches for studying membrane transport processes. By reconstituting ECF transporters into lipid bilayers suspended across nanopores, researchers can measure electrical currents associated with conformational changes during transport, providing a direct readout of protein dynamics in a native-like membrane environment.

How might comparative studies between pathogenic and non-pathogenic Listeria species inform ECF transporter research?

Comparative studies between pathogenic Listeria monocytogenes and non-pathogenic Listeria innocua offer valuable insights into ECF transporter evolution and specialization. Although L. innocua is generally considered non-pathogenic, the documented fatal case of L. innocua bacteremia indicates potential virulence capabilities that may correlate with ECF transporter functions . Systematic comparison of ECF transporter gene organization, expression patterns, and substrate specificities between these closely related species can reveal adaptations associated with their different ecological niches and pathogenic potential.

The greater heat resistance observed in L. innocua compared to L. monocytogenes (with decimal reduction times 1.5 to 3 times longer) suggests differences in stress response mechanisms that may involve ECF transporters . Comparative transcriptomics under stress conditions could identify differential regulation of ecfT and associated genes, potentially explaining the enhanced thermal tolerance of L. innocua. This knowledge has significant implications for food safety, as L. innocua is often used as a surrogate for L. monocytogenes in validation studies due to its similar growth characteristics but enhanced survival under processing conditions .

Genome-wide association studies across multiple Listeria species and strains can identify ECF transporter variants associated with specific phenotypes such as stress tolerance, growth in nutrient-limited environments, or survival in food processing facilities. By correlating genotypic differences in ecfT with phenotypic traits, researchers can establish causal relationships between transporter structure and function in different ecological contexts.

Furthermore, heterologous expression studies where ecfT genes from L. monocytogenes are expressed in L. innocua backgrounds (and vice versa) can directly test the contribution of species-specific EcfT variants to phenotypic differences. These functional complementation approaches provide mechanistic insights into how subtle sequence variations translate to functional specialization in closely related bacterial species.

What potential applications exist for engineered L. innocua ECF transporters in biotechnology?

Engineered Listeria innocua ECF transporters present numerous potential applications in biotechnology, leveraging their substrate specificity and transport efficiency. As non-pathogenic alternatives to L. monocytogenes, engineered L. innocua strains with modified ECF transporters offer biosafe platforms for various biotechnological applications.

In bioremediation, engineered ECF transporters could enhance uptake of specific environmental contaminants or heavy metals by modifying the substrate-binding EcfS component while maintaining the EcfT coupling architecture. This approach creates microbial systems capable of sequestering toxins from soil or water. The inherent heat resistance of L. innocua (with D-values 1.5-3 times higher than L. monocytogenes) provides additional advantages for environmental applications under fluctuating temperature conditions .

For metabolic engineering applications, modified ECF transporters can enhance nutrient uptake to overcome rate-limiting steps in biosynthetic pathways. By engineering the substrate specificity of the EcfS component while maintaining interaction with the native EcfT protein, researchers can develop strains with enhanced uptake of specific precursors or vitamins required for valuable metabolite production. The modular nature of ECF transporters, where different EcfS components interact with a conserved EcfT, makes them particularly amenable to such engineering approaches.

Biosensor development represents another promising application area. By coupling engineered ECF transporters with reporter systems, researchers can create whole-cell biosensors that detect specific analytes with high sensitivity. When the target molecule is transported by the modified ECF system, it triggers expression of a reporter gene, providing visual or electrical signals proportional to analyte concentration. L. innocua's robust growth characteristics and non-pathogenic nature make it an ideal chassis for such biosensor applications in food safety, environmental monitoring, and medical diagnostics.

Finally, vaccine development could benefit from engineered L. innocua strains with modified ECF transporters. By optimizing nutrient uptake and stress resistance, researchers can develop stable L. innocua strains for heterologous antigen expression. The documented ability to transform L. innocua with plasmids conferring antibiotic resistance (as in the case of L. innocua PFEI with chloramphenicol and erythromycin resistance) demonstrates the feasibility of genetic modification approaches needed for these applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.