Recombinant Listeria innocua serovar 6a Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; lsp; lin1958; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
lspA
Target Protein Sequence
MYYYLITLAVIALDQLTKWIVVQNMEIGQKIEVIPGFLYWTSYRNDGAAWSILEGHMWFF YLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRILHQEVVDFVQTVWGNY YFPIFNVADAALSVGVVLMLVYVFVDDRKTKGIK
Uniprot No.

Target Background

Function

This protein is a specific catalyst in the removal of signal peptides from prolipoproteins.

Database Links

KEGG: lin:lsp

STRING: 272626.lin1958

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Listeria innocua?

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an essential enzyme in Listeria innocua that plays a critical role in the processing of prolipoproteins. The lspA gene encodes this membrane-bound protease (EC 3.4.23.36) responsible for cleaving the signal peptide from prolipoproteins during their maturation process. In Listeria innocua serovar 6a (strain CLIP 11262), lspA is identified by the Uniprot accession number Q92AG4 and is encoded by the gene locus lin1958 .

Genomic characterization studies have consistently found lspA among the 13 virulence genes present in all examined L. innocua isolates, suggesting its essential role in bacterial function . While L. innocua is generally considered non-pathogenic, the presence of lspA and other virulence genes indicates shared genetic elements with pathogenic Listeria species, particularly L. monocytogenes .

How does lspA contribute to Listeria innocua functionality?

The lspA enzyme serves multiple critical functions in Listeria innocua:

  • Lipoprotein processing: As a signal peptidase, lspA cleaves signal peptides from prolipoproteins, an essential step in lipoprotein maturation. This processing is crucial for proper targeting and anchoring of lipoproteins to the bacterial cell membrane.

  • Membrane integrity: Properly processed lipoproteins contribute significantly to cell envelope stability and function, influencing bacterial survival under various environmental conditions.

  • Surface protein anchoring: Genomic studies classify lspA among genes involved in surface protein anchoring, which mediates bacterial interactions with the environment and potentially with host cells in the case of pathogenic species .

  • Virulence potential: While L. innocua lacks the complete Listeria Pathogenicity Island 1 (LIPI-1) found in pathogenic L. monocytogenes, it consistently carries lspA along with other virulence-associated genes like clpC, clpE, clpP, hbp1, svpA, hbp2, iap/cwhA, lap, lpeA, lplA1, oatA, pdgA, and prsA2 . This suggests lspA may contribute to the bacterium's ecological fitness and potentially to virulence-like properties.

The consistent presence of lspA across diverse L. innocua isolates from various sources, including cattle farms, beef abattoirs, and retail outlets, underscores its fundamental importance to bacterial physiology .

What experimental designs are appropriate for studying lspA functionality?

When investigating lspA functionality, researchers should select experimental designs based on specific research questions. Three main experimental design approaches can be effectively applied:

Independent Groups Design

This design involves using different bacterial samples for each experimental condition, allowing clear comparison of lspA function across different strains or conditions.

Strengths:

  • Eliminates order effects as each sample is tested only once

  • Allows simultaneous testing of multiple conditions if resources permit

  • Prevents cross-contamination between experimental conditions

Weaknesses:

  • Requires more samples, potentially increasing resource requirements

  • Individual differences between bacterial cultures may introduce variability

  • Data from one condition cannot inform interpretation of other conditions

Repeated Measures Design

In this approach, the same bacterial cultures are subjected to multiple experimental conditions sequentially, allowing direct comparison of lspA functionality under different treatments.

Weaknesses:

  • Potential for order effects, requiring counterbalancing of treatment sequences

  • Loss of a sample impacts data across all conditions

  • May be impractical for treatments that permanently alter bacteria

Matched Pairs Design

This hybrid approach matches similar bacterial cultures and assigns them to different conditions based on relevant characteristics (e.g., growth rate, genetic background).

Strengths:

  • Balances the advantages of both previous designs

  • Reduces variability compared to independent groups

  • Eliminates ordering effects present in repeated measures

Recommendations for lspA Studies:

  • Use independent groups design for comparing lspA across different Listeria strains

  • Apply repeated measures design when testing environmental effects on lspA expression

  • Consider genomic approaches like whole-genome sequencing to place lspA in broader genetic context

What are the optimal conditions for expressing recombinant lspA?

Successful expression of recombinant Listeria innocua serovar 6a lspA requires careful optimization of expression systems and conditions:

Expression System Selection

Bacterial Expression Systems:

  • Modified E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) specifically designed for membrane protein expression

  • Consider codon optimization for the E. coli expression system

  • Fusion tags (e.g., MBP, SUMO) may improve solubility and expression yield

Alternative Expression Systems:

  • Cell-free expression systems for challenging membrane proteins

  • Yeast or insect cell expression for complex membrane proteins requiring eukaryotic processing machinery

Expression Conditions Optimization

Temperature and Induction Parameters:

  • Lower temperatures (16-25°C) often improve proper folding of membrane proteins

  • Gradual induction with lower inducer concentrations (0.1-0.5 mM IPTG for lac-based systems)

  • Extended expression periods (overnight to 72 hours) at reduced temperatures

Media and Supplements:

  • Enriched media formulations (2XYT, TB, or auto-induction media)

  • Addition of membrane-stabilizing agents (glycerol 5-10%)

  • Osmolytes (betaine, sorbitol) to enhance proper folding

Protein Extraction and Storage

Based on available protocols for recombinant lspA:

  • Store in Tris-based buffer with 50% glycerol

  • Maintain at -20°C for regular use or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be kept at 4°C for up to one week

The high hydrophobicity of lspA necessitates careful optimization of expression conditions, with particular attention to membrane integration and proper folding during expression.

How can researchers purify recombinant lspA for experimental use?

Purification of recombinant Listeria innocua serovar 6a lspA requires specialized protocols to address the challenges associated with membrane protein isolation:

Step 1: Membrane Fraction Isolation

  • Harvest bacterial cells by centrifugation (5,000 × g, 15 minutes, 4°C)

  • Resuspend cell pellet in lysis buffer containing protease inhibitors

  • Disrupt cells using sonication or mechanical methods (French press, bead beater)

  • Remove cellular debris by low-speed centrifugation (10,000 × g, 20 minutes, 4°C)

  • Collect membrane fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C)

Step 2: Detergent Solubilization

  • Resuspend membrane pellet in solubilization buffer containing appropriate detergents

    • Consider detergent screening panel: DDM, LDAO, OG, DMNG, or SMA copolymers

  • Incubate with gentle agitation (3-16 hours at 4°C)

  • Remove insoluble material by ultracentrifugation (100,000 × g, 45 minutes, 4°C)

  • Collect detergent-solubilized supernatant containing lspA

Step 3: Affinity Purification

  • Apply solubilized fraction to appropriate affinity resin based on fusion tag

  • For His-tagged lspA, use Ni-NTA or TALON resin with detergent-containing buffers

  • Wash extensively to remove non-specifically bound proteins

  • Elute using competitive elution (imidazole for His-tag) or enzymatic tag cleavage

Step 4: Further Purification

  • Size exclusion chromatography to separate monomeric lspA from aggregates

  • Monitor protein quality using analytical techniques (dynamic light scattering, SDS-PAGE)

  • Concentrate purified protein using centrifugal concentrators with appropriate MWCO

Step 5: Quality Control

  • Assess purity by SDS-PAGE (>95% purity recommended for structural studies)

  • Verify identity by western blotting and/or mass spectrometry

  • Evaluate activity using functional assays specific to signal peptidase activity

Storage Considerations

Store purified lspA in Tris-based buffer with 50% glycerol. For short-term storage, maintain at -20°C; for long-term preservation, store at -80°C. Always prepare working aliquots to avoid repeated freeze-thaw cycles .

How does lspA in Listeria innocua compare to similar proteins in pathogenic Listeria species?

Comparative analysis of lspA between Listeria innocua and pathogenic Listeria species reveals important insights into evolutionary relationships and functional significance:

Sequence and Structural Conservation

The lspA protein demonstrates high sequence conservation between L. innocua and L. monocytogenes, reflecting its essential cellular function. This conservation extends to the catalytic mechanism and structural organization of the protein, suggesting similar enzymatic activities across Listeria species. The core functional domains responsible for signal peptide recognition and cleavage appear to be largely conserved .

Genomic Context Differences

Despite protein-level conservation, the genomic context of lspA differs significantly between species:

L. innocua Context:

  • lspA exists alongside 13 other virulence genes involved in adhesion, invasion, protein anchoring, and stress response

  • Lacks the complete Listeria Pathogenicity Island 1 (LIPI-1) that is essential for L. monocytogenes virulence

  • Often found in genomic arrangements suggesting potential horizontal gene transfer events

L. monocytogenes Context:

  • lspA functions within a comprehensive virulence network including LIPI-1 genes

  • Integrated with internalins and other invasion-promoting factors

  • Expression coordinated with other virulence determinants via PrfA-dependent regulation

Functional Implications

The presence of lspA in both pathogenic and non-pathogenic Listeria species raises important questions about its role in virulence:

  • In L. monocytogenes, lspA is part of a coordinated virulence machinery enabling host invasion and intracellular survival.

  • In L. innocua, lspA likely contributes to general cellular functions and environmental adaptation, but in the absence of other key virulence determinants, does not confer pathogenicity.

  • The high conservation suggests lspA is primarily involved in essential cellular processes, with its contribution to virulence being indirect through proper processing of other virulence-associated lipoproteins .

This comparative understanding provides valuable insights into bacterial evolution and the minimal genetic requirements for pathogenicity within the Listeria genus.

What role does lspA play in virulence potential of Listeria innocua?

Although Listeria innocua is generally considered non-pathogenic, the consistent presence of lspA and other virulence genes raises important questions about its virulence potential:

Evidence for Virulence Association

Multiple genomic characterization studies have found lspA among 13 virulence genes consistently present in L. innocua isolates from diverse sources. These genes are involved in crucial processes including:

  • Surface protein anchoring: lspA contributes to proper processing and localization of surface-associated proteins, potentially influencing interactions with host cells

  • Adhesion and invasion: Several virulence genes co-occurring with lspA (like iap/cwhA) participate in adhesion processes

  • Stress response: Heat shock proteins and stress response genes (clpC, clpE, clpP) found alongside lspA enable bacterial survival under adverse conditions

Virulence Potential Assessment

Despite carrying these virulence genes, L. innocua lacks the complete Listeria Pathogenicity Island 1 (LIPI-1), which contains key virulence determinants of L. monocytogenes including the central virulence regulator PrfA . This absence likely explains L. innocua's generally non-pathogenic nature despite possessing lspA and other virulence-associated genes.

The presence of identical lspA sequences across multiple sequence types (STs) of L. innocua (including ST637, ST448, ST537, and ST1085) suggests that this gene is part of the core genome rather than a recently acquired virulence determinant . This supports the hypothesis that lspA primarily serves essential cellular functions, with its role in virulence being indirect.

Evolutionary and Public Health Implications

The genomic similarity between L. innocua and L. monocytogenes, particularly in shared virulence genes like lspA, raises concerns about potential gene transfer when these species co-exist in the same environments. Research indicates that these bacteria can exchange genetic material, potentially enhancing the virulence potential of traditionally non-pathogenic strains .

This understanding of lspA's role in L. innocua has significant implications for food safety and bacterial evolution monitoring, particularly in environments where multiple Listeria species coexist.

How might lspA be targeted in antimicrobial research?

Lipoprotein signal peptidase (lspA) represents a promising antimicrobial target due to its essential function and conservation across Listeria species. Several approaches can be considered for targeting this enzyme:

Inhibitor Development Strategies

Small Molecule Inhibitors:

  • Design competitive inhibitors that mimic the natural substrate of lspA

  • Develop transition-state analogues that bind irreversibly to the catalytic site

  • Screen chemical libraries for compounds that block the peptidase activity of lspA

Peptide-Based Approaches:

  • Design peptidomimetics that compete with natural substrates

  • Develop peptide inhibitors targeting the substrate binding pocket

  • Create domain-specific binding molecules that interfere with protein-protein interactions

Structure-Based Design:

  • Utilize 3D structural information of lspA for rational inhibitor design

  • Identify allosteric sites that may allow modulation of enzymatic activity

  • Employ computational docking to predict binding modes of potential inhibitors

Therapeutic Potential Assessment

The antimicrobial potential of targeting lspA is supported by several factors:

  • Essentiality: lspA plays a crucial role in lipoprotein processing, which is vital for bacterial membrane integrity.

  • Conservation: The high conservation of lspA across Listeria species suggests limited potential for resistance development through target modification.

  • Accessibility: As a membrane-associated enzyme, lspA may be more accessible to inhibitors compared to intracellular targets.

  • Ensuring selectivity for bacterial lspA over host proteases

  • Achieving sufficient membrane penetration for effective inhibition

  • Addressing potential resistance mechanisms

Current Antimicrobial Resistance Context

Research on Listeria isolates has identified various antimicrobial resistance genes, including lin, fosX, and tet(M) . The emergence of resistance underscores the need for novel antimicrobial targets like lspA. Targeting essential processes such as lipoprotein processing could provide new therapeutic options for controlling Listeria species, particularly in cases where conventional antibiotics are ineffective.

What statistical approaches are recommended for analyzing lspA expression data?

Analysis of lspA expression data requires appropriate statistical methods based on the experimental design and data type collected:

For Transcriptomic Data Analysis

Preprocessing and Normalization:

  • Apply appropriate normalization methods (RPKM/FPKM for RNA-seq or reference gene normalization for qRT-PCR)

  • Perform data transformation if necessary to achieve normal distribution

  • Use specialized packages like DESeq2 or edgeR for RNA-seq count data

Comparison Methods:

  • For two-group comparisons: t-tests (parametric) or Mann-Whitney U tests (non-parametric)

  • For multi-group comparisons: ANOVA with appropriate post-hoc tests (Tukey's HSD or Dunnett's test)

  • For time-course experiments: repeated measures ANOVA or linear mixed models

Sample Size Considerations:

  • Conduct power analysis to determine appropriate sample sizes

  • For RNA-seq studies, a minimum of 3-6 biological replicates per condition is recommended

  • For qRT-PCR validation, increase to 5-8 biological replicates with technical triplicates

For Genomic Variation Analysis

Sequence Type (ST) Distribution:

  • Chi-square or Fisher's exact tests to compare ST frequencies across different sources

  • Multinomial logistic regression to identify factors associated with specific STs

Example from Research:
Studies on L. innocua have demonstrated significant differences (p < 0.05) in the frequencies of sequence types, with ST637 (26.4%), ST448 (20%), ST537 (13.6%), and ST1085 (12.7%) predominating in specific ecological niches .

For Correlation Analysis

Relationship Assessment:

  • Pearson correlation for normally distributed continuous data

  • Spearman rank correlation for non-parametric analyses

  • Multiple regression for identifying predictors of lspA expression

Data Visualization:

  • Create scatter plots with regression lines to visualize relationships

  • Use heatmaps for visualizing correlations between multiple genes

  • Implement principal component analysis (PCA) to identify patterns in complex datasets

When analyzing virulence gene frequency data, researchers should pay particular attention to potential confounding factors such as isolation source, geographic location, and temporal variations, as these have been shown to influence the distribution of virulence genes including lspA in Listeria populations .

How can researchers address conflicting results in lspA studies?

Resolving conflicting findings in lspA research requires systematic approaches to identify and address sources of variation:

Methodological Standardization

Protocol Harmonization:

  • Develop and implement standardized protocols for lspA detection and characterization

  • Clearly document methodological details, including primer sequences, PCR conditions, and detection thresholds

  • Participate in inter-laboratory validation studies to ensure reproducibility

Reference Material Establishment:

  • Create reference strains with well-characterized lspA variants

  • Develop standard positive and negative controls for molecular detection methods

  • Establish calibration standards for quantitative analyses

Biological Variation Assessment

Strain-Level Characterization:

  • Conduct whole-genome sequencing to fully characterize strains used in research

  • Implement multilocus sequence typing (MLST) to classify isolates into sequence types

  • Document strain origins and passage history to account for laboratory adaptation

Environmental Factors:

  • Record and report growth conditions in detail (medium, temperature, oxygen levels)

  • Assess the impact of environmental stressors on lspA expression

  • Consider source-specific adaptations when comparing isolates from different origins

Integration of Multiple Data Types

Multi-Omics Approaches:

  • Combine genomic, transcriptomic, and proteomic data to develop comprehensive understanding

  • Correlate genotypic data with phenotypic observations

  • Implement systems biology approaches to place lspA in broader cellular context

Meta-Analysis Techniques:

  • Conduct formal meta-analyses of published data using appropriate statistical methods

  • Account for between-study heterogeneity using random-effects models

  • Assess publication bias through funnel plot analysis or related techniques

Example Application

When addressing conflicting findings regarding virulence gene prevalence in Listeria, researchers should consider:

  • Isolation sources (retail outlets vs. production facilities vs. clinical samples)

  • Detection methodologies (PCR-based vs. whole-genome sequencing)

  • Sequence type distributions, which can vary significantly by geographic region

  • Temporal changes in bacterial populations

Studies have demonstrated significant differences in virulence gene distribution based on isolation source, with lspA and other virulence genes showing varying frequencies across cattle farms, abattoirs, and retail outlets (p < 0.05) .

What bioinformatic tools are most appropriate for lspA sequence analysis?

Comprehensive analysis of Listeria innocua lspA sequences requires a suite of specialized bioinformatic tools addressing different aspects:

Sequence Identification and Characterization

Homology Search Tools:

  • BLASTP/BLASTN for identifying lspA homologs across bacterial genomes

  • Position-Specific Iterative BLAST (PSI-BLAST) for detecting distant homologs

  • HMMER for profile-based searches using hidden Markov models

Annotation and Functional Prediction:

  • InterProScan for protein domain identification and functional classification

  • Prokka or RAST for automated genome annotation including lspA identification

  • SignalP and LipoP for signal peptide and lipoprotein prediction

Sequence Feature Analysis:

  • TMHMM or TOPCONS for transmembrane topology prediction

  • NetTurnP for β-turn prediction in the catalytic region

  • ConSurf for evolutionary conservation analysis

Evolutionary and Comparative Analysis

Multiple Sequence Alignment:

  • MUSCLE or MAFFT for aligning lspA sequences

  • T-Coffee for alignment incorporating structural information

  • Clustal Omega for large-scale alignments

Phylogenetic Analysis:

  • RAxML or IQ-TREE for maximum likelihood tree construction

  • MrBayes for Bayesian phylogenetic inference

  • MEGA for comprehensive phylogenetic analysis with user-friendly interface

Comparative Genomics:

  • Mauve for visualization of genomic synteny around lspA

  • Roary for pan-genome analysis to place lspA in genomic context

  • OrthoMCL for ortholog clustering across multiple genomes

Virulence and Resistance Analysis

Specialized Databases:

  • VFDB (Virulence Factor Database) for virulence gene identification

  • CARD (Comprehensive Antibiotic Resistance Database) for resistance gene detection

  • PATRIC for integrated pathogen genome and antimicrobial resistance analysis

Example Application in Research:
In Listeria studies, these tools have been successfully employed to analyze sequence data. For instance, BLAST-based analyses identified antimicrobial resistance genes like lin (100%), fosX (100%), and tet(M) (30%) across Listeria isolates . Similarly, in silico MLST has been used to identify diverse sequence types, demonstrating significant variation in sequence type distribution across different sources (p < 0.05) .

For lspA specifically, researchers should implement a workflow combining:

  • Sequence retrieval and quality assessment

  • Homology-based identification and annotation

  • Structural and functional prediction

  • Evolutionary analysis in the context of other Listeria species

  • Integration with metadata on isolation source and phenotypic characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.