Recombinant Listeria innocua serovar 6a Membrane protein insertase YidC 2 (yidC2)

What is YidC2 and what is its role in Listeria innocua serovar 6a?

YidC2 in Listeria innocua serovar 6a functions as a membrane protein insertase, facilitating the integration of proteins into bacterial membranes. It plays a critical role in membrane protein biogenesis by assisting in the folding, insertion, and assembly of integral membrane proteins. As a member of the evolutionarily conserved YidC/Oxa1/Alb3 protein family, it is essential for maintaining membrane integrity and proper protein trafficking. The YidC2 protein in L. innocua consists of 287 amino acids (mature protein spanning residues 27-287) and contains multiple transmembrane domains that anchor it within the bacterial membrane .

How should recombinant YidC2 protein be stored and reconstituted for optimal activity?

For optimal stability, store lyophilized YidC2 protein at -20°C to -80°C. Avoid repeated freeze-thaw cycles which can compromise protein integrity. Prior to opening, briefly centrifuge the vial to collect contents at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot before storing at -20°C to -80°C. Working aliquots can be maintained at 4°C for up to one week, but extended storage at this temperature is not recommended . The reconstitution buffer typically contains Tris/PBS components with 6% trehalose at pH 8.0, which helps maintain protein stability. When planning experiments, allow sufficient time for proper reconstitution and equilibration of the protein .

What expression systems are commonly used for producing recombinant YidC2, and how do they affect protein quality?

E. coli is the predominant expression system for producing recombinant Listeria innocua YidC2 protein, as evidenced by commercial preparations . This prokaryotic expression system offers advantages for membrane proteins from bacterial sources due to similar cellular machinery. Alternative expression systems include yeasts (Pichia pastoris, Saccharomyces cerevisiae) for higher eukaryotic protein folding capacity, insect cells using baculovirus for complex proteins requiring post-translational modifications, and cell-free systems for toxic membrane proteins.

For YidC2 specifically, E. coli systems typically yield protein with greater than 90% purity as determined by SDS-PAGE . The choice of expression system significantly impacts final protein quality, with considerations including: proper folding (especially critical for membrane proteins), yield (typically lower for membrane proteins), post-translational modifications (minimal in E. coli), and potential endotoxin contamination (higher risk in E. coli systems but can be addressed with additional purification steps). For structural studies requiring highly pure, properly folded YidC2, extensive optimization of expression conditions and purification protocols is essential.

How does the structure of YidC2 from Listeria innocua compare to homologs in other bacterial species?

YidC2 from Listeria innocua serovar 6a shares structural similarities with other bacterial YidC homologs but exhibits species-specific variations. The full-length mature protein (amino acids 27-287) contains transmembrane helices characteristic of the YidC/Oxa1/Alb3 family . The protein sequence (CGYSTDPITKDSTGFWSHYIVFPLSWVITWFSDLFGGNYAVGIIVVTILIRLLIMPLMIKQLKSQKAMTSLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMPILLGFYQAISRTAEIKTDTFLWMQLGNPDPYYILPIVAALTTFLSSKISMMGQTQQNKSMAMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQLEEER-LKKKAANMKASKKGGKKRK) reveals hydrophobic regions consistent with membrane integration domains .

Comparative structural analysis with YidC proteins from model organisms like E. coli and B. subtilis indicates conservation of the core membrane insertase domain but differences in peripheral regions that may reflect adaptation to specific membrane compositions or substrate repertoires. The C-terminal region contains positively charged residues (LKKKAANMKASKKGGKKRK) that likely interact with the negatively charged phospholipid headgroups on the cytoplasmic side of the membrane, following the "positive-inside rule" of membrane protein topology. Unlike some bacterial YidCs, the Listeria innocua YidC2 lacks large periplasmic domains, suggesting a more streamlined insertase function potentially specializing in a narrower range of substrate proteins.

What experimental approaches are most effective for studying the membrane insertion activity of YidC2?

For investigating the membrane insertion activity of YidC2, several complementary experimental approaches yield comprehensive insights:

• In vitro reconstitution systems: Purified YidC2 can be reconstituted into proteoliposomes to study its insertase activity directly. This method requires:

  • Preparation of lipid vesicles mimicking bacterial membrane composition

  • Incorporation of purified YidC2 protein using detergent-mediated methods

  • Addition of radiolabeled or fluorescently tagged substrate proteins

  • Analysis of insertion efficiency through protease protection assays

• Site-directed cross-linking: To identify interaction sites between YidC2 and substrate proteins:

  • Introduction of photoreactive amino acids at specific positions in YidC2

  • UV-induced cross-linking with substrates during the insertion process

  • Mass spectrometric analysis to identify cross-linked residues

• Single-molecule techniques: For real-time monitoring of insertion events:

  • Förster resonance energy transfer (FRET) between labeled YidC2 and substrates

  • Total internal reflection fluorescence (TIRF) microscopy of reconstituted systems

  • Atomic force microscopy to visualize YidC2-mediated membrane perturbations

• Genetic complementation assays: To validate function in vivo:

  • Expression of Listeria innocua YidC2 in YidC-depleted E. coli strains

  • Assessment of growth rescue and membrane protein expression levels

  • Comparison with known functional variants of YidC proteins

These techniques should be employed with appropriate controls, including YidC2 mutants with altered insertase activity and comparison with other insertase systems like the Sec translocon .

How can researchers differentiate between the functions of YidC1 and YidC2 in Listeria species?

To differentiate between YidC1 and YidC2 functions in Listeria species, researchers should implement a multi-faceted approach:

• Gene knockout studies:

  • Generate single and double knockout mutants (ΔyidC1, ΔyidC2, and ΔyidC1ΔyidC2 if viable)

  • Analyze growth phenotypes under various conditions (temperature, osmotic stress, pH)

  • Examine membrane protein profiles by proteomics to identify specific substrate dependencies

• Substrate specificity determination:

  • Perform pulldown assays with tagged YidC1 and YidC2 to identify interacting proteins

  • Use quantitative proteomics to compare membrane proteome changes in ΔyidC1 versus ΔyidC2 strains

  • Employ in vitro translation-insertion assays with purified YidC1 and YidC2 to test candidate substrates

• Complementation experiments:

  • Express YidC1 in ΔyidC2 strains and vice versa to assess functional overlap

  • Utilize chimeric proteins containing domains from both YidC1 and YidC2 to map functional regions

  • Test cross-species complementation with YidC homologs from other bacteria

• Structural and localization studies:

  • Compare subcellular localization patterns using fluorescently tagged YidC1 and YidC2

  • Analyze potential differences in oligomeric states using size exclusion chromatography

  • Examine lipid preferences through reconstitution in different membrane mimetics

These approaches should reveal the degree of functional redundancy and specialization between YidC1 and YidC2, which may differ in substrate preference, efficiency of insertion, or involvement in specific stress responses in Listeria innocua compared to pathogenic Listeria species .

What evidence exists for horizontal gene transfer of yidC2 between Listeria innocua and other bacterial species?

The analysis of genomic contexts surrounding yidC2 in Listeria innocua and related bacteria provides several lines of evidence suggesting potential horizontal gene transfer (HGT) events:

• Comparative genomic analysis: Examination of the yidC2 sequence across multiple Listeria species reveals variable conservation patterns that don't consistently align with species phylogeny, suggesting potential horizontal acquisition events rather than strict vertical inheritance .

• Genomic island characteristics: The regions flanking yidC2 in L. innocua serovar 6a may exhibit hallmarks of genomic islands, including:

  • Altered GC content compared to the chromosomal average

  • Presence of mobility-associated genes (transposases, integrases)

  • Association with tRNA genes, which often serve as integration sites

• Comparative analysis with pathogenic Listeria: The high genomic similarity between L. innocua and L. monocytogenes, along with their coexistence in similar ecological niches, creates opportunities for gene transfer events. The genomic context of yidC2 should be compared between these species to identify potential transfer patterns .

• Phylogenetic incongruence: When phylogenetic trees based on yidC2 sequences differ from those based on conserved housekeeping genes or whole-genome analyses, this suggests HGT events have occurred during evolution.

This evidence must be interpreted carefully, as sequence similarities can also result from selective pressures rather than HGT. Additionally, the functional conservation of membrane insertases across bacteria may complicate distinguishing true HGT events from convergent evolution .

How does the presence of pathogenicity islands in Listeria innocua relate to the function of YidC2?

The relationship between pathogenicity islands in Listeria innocua and YidC2 function represents a complex interplay between virulence determinants and membrane protein biogenesis:

• LIPI-4 in L. innocua: Recent genomic analyses have revealed that many L. innocua strains, including the three multi-drug resistant isolates studied by Yan et al., harbor listeria pathogenicity island-4 (LIPI-4), despite L. innocua being generally considered non-pathogenic . This LIPI-4 is associated with central nervous system invasion and maternal-neonatal infection in the pathogenic L. monocytogenes.

• Potential functional interactions: As a membrane protein insertase, YidC2 may play a role in the proper localization and insertion of membrane-associated virulence factors encoded by pathogenicity islands. This creates several potential interactions:

  • YidC2 could be essential for the membrane integration of LIPI-4-encoded proteins

  • Changes in YidC2 expression or function might modulate the presentation of virulence factors

  • Co-evolution between insertion machinery and virulence determinants might occur

• Evolutionary implications: The presence of both LIPI-4 and yidC2 in L. innocua suggests these elements could be transferred as a functional unit between Listeria species. Phylogenetic analysis of LIPI-4 sequences from both L. innocua and L. monocytogenes indicates species-specific clustering but with evidence suggesting potential common origins .

• Public health considerations: The presence of pathogenicity islands in L. innocua, combined with the potential for resistance gene transfer facilitated by membrane protein machinery, raises concerns about L. innocua serving as a reservoir for virulence determinants that could be transferred to pathogenic Listeria species .

The broader implications suggest that L. innocua, traditionally considered non-pathogenic, may require more attention in food surveillance programs due to its potential role in the evolution of virulence in Listeria species .

What are the critical factors affecting successful reconstitution of YidC2 for functional studies?

Successful reconstitution of YidC2 for functional studies depends on several critical factors that must be carefully optimized:

• Detergent selection and removal:

  • Initial solubilization requires mild detergents (e.g., DDM, LDAO) that preserve protein structure

  • Detergent removal rate during reconstitution affects insertion orientation and efficiency

  • Recommended methods include dialysis for gentle removal or Bio-Beads for faster extraction

• Lipid composition:

  • Mimic native Listeria membrane composition (phosphatidylglycerol, cardiolipin)

  • Lipid-to-protein ratio typically between 50:1 to 200:1 (w/w) affects protein density

  • Inclusion of specific lipids like cardiolipin (1-5%) may enhance activity

• Buffer optimization:

  • Maintain pH 7.0-8.0 with appropriate buffering agents (HEPES, Tris)

  • Include stabilizing agents such as glycerol (10%) and trehalose (6%)

  • Control ionic strength (100-300 mM KCl or NaCl) to prevent aggregation

• Reconstitution methodology:

  Method	Advantages	Disadvantages	Best For
  Dialysis	Gentle, high incorporation	Time-consuming	Sensitive proteins
  Bio-Beads	Rapid, scalable	Less control	Robust proteins
  Dilution	Simple procedure	Lower efficiency	Initial screening
  Extrusion	Uniform vesicle size	Potential protein damage	Biophysical studies

• Verification steps:

  • Confirm orientation using protease accessibility assays

  • Assess incorporation efficiency through density gradient centrifugation

  • Verify function using model substrate proteins

Recombinant YidC2 from Listeria innocua serovar 6a requires careful handling during reconstitution steps to maintain the native-like structure essential for functional studies. The protein should be reconstituted immediately after purification or stored properly with stabilizing agents to prevent aggregation .

How can researchers troubleshoot poor expression or solubility issues with recombinant YidC2?

Troubleshooting poor expression or solubility issues with recombinant YidC2 requires systematic optimization of multiple parameters:

• Expression system optimization:

  • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3) specialized for membrane proteins)

  • Evaluate different promoter systems (T7, arabinose-inducible, rhamnose-inducible)

  • Optimize codon usage for Listeria genes expressed in E. coli

  • Consider bacterial cell-free systems for toxic membrane proteins

• Expression conditions:

  • Reduce induction temperature (16-20°C) to slow protein production

  • Decrease inducer concentration (0.1-0.5 mM IPTG instead of 1 mM)

  • Use enriched media (TB, 2XYT) supplemented with glucose (0.5-1%)

  • Extend expression time (overnight) at lower temperatures

• Fusion tag strategies:

  • Test N-terminal vs. C-terminal His-tag placement

  • Evaluate solubility-enhancing fusion partners (MBP, SUMO, Trx)

  • Consider dual tagging systems for enhanced purification options

  • Include cleavable linkers between tags and YidC2

• Solubilization approaches:

  • Screen multiple detergents systematically:

    Detergent Class	Examples	Concentration Range	Best For
    Mild non-ionic	DDM, LMNG	1-2%	Initial extraction
    Zwitterionic	LDAO, FC-12	0.5-2%	Enhanced solubilization
    Steroid-based	Digitonin, GDN	0.5-1%	Native-like activity
    Polymeric	SMA, amphipols	Varied	Detergent-free systems

  • Test detergent mixtures for synergistic effects

  • Include stabilizing agents (glycerol, specific lipids)

  • Optimize solubilization time, temperature, and buffer conditions

• Protein quality assessment:

  • Analyze aggregation state by size-exclusion chromatography

  • Verify proper folding using circular dichroism spectroscopy

  • Test functional activity with simplified assays before proceeding to complex studies

When working with the His-tagged Listeria innocua YidC2, researchers should be particularly attentive to potential interference between the tag and membrane integration domains. Strategic placement of the His-tag and consideration of a cleavable linker may improve both expression and subsequent activity .

What are the best methods for assessing the purity and structural integrity of recombinant YidC2?

Comprehensive assessment of recombinant YidC2 purity and structural integrity requires a multi-technique approach:

• Purity assessment:

  • SDS-PAGE with Coomassie or silver staining (>90% purity is typical for high-quality preparations)

  • Western blotting using anti-His antibodies for tagged constructs

  • Mass spectrometry for precise identification and purity assessment:

    • MALDI-TOF for molecular weight confirmation

    • LC-MS/MS for peptide coverage and contaminant identification

• Homogeneity analysis:

  • Size exclusion chromatography to evaluate oligomeric state and aggregation

  • Dynamic light scattering to assess particle size distribution

  • Analytical ultracentrifugation for precise determination of molecular species

• Structural integrity evaluation:

  • Circular dichroism spectroscopy for secondary structure composition

  • Fluorescence spectroscopy to assess tertiary structure integrity

  • Limited proteolysis patterns to confirm proper folding

  • Thermal shift assays to determine protein stability

• Functional verification:

  • Lipid binding assays using fluorescent lipid probes

  • Substrate binding studies with model membrane proteins

  • Reconstitution efficiency into liposomes

  • Activity assays using reporter substrate proteins

• Membrane integration assessment:

  • Sucrose density gradient analysis of proteoliposomes

  • Freeze-fracture electron microscopy of reconstituted samples

  • Protease protection assays to confirm correct topology

For the Listeria innocua YidC2 protein specifically, researchers should be mindful that membrane proteins can appear pure by SDS-PAGE standards (>85-90% purity) but still contain significant amounts of bound detergent, lipids, or small contaminants that affect functional studies. Therefore, combining multiple analytical techniques provides the most reliable assessment of protein quality before proceeding to detailed functional characterization .

How might YidC2 function contribute to antimicrobial resistance in Listeria species?

YidC2 function may contribute to antimicrobial resistance in Listeria species through several direct and indirect mechanisms:

• Membrane protein integration role:

  • YidC2 facilitates the insertion of membrane proteins, potentially including efflux pumps and transporters involved in antibiotic resistance

  • Altered YidC2 expression or function could modify the membrane proteome composition, affecting permeability barriers to antibiotics

  • Co-evolution of YidC2 with specific antimicrobial resistance determinants may enhance efficiency of resistance protein insertion

• Genomic context and horizontal gene transfer:

  • The yidC2 gene in multi-drug resistant (MDR) L. innocua isolates exists in a genomic environment that may facilitate co-transfer with resistance determinants

  • Research on MDR L. innocua has identified multiple resistance gene islands and plasmids that may contain or interact with membrane protein assembly machinery

  • The potential role of YidC2 in incorporating plasmid-encoded resistance proteins into the membrane merits investigation

• Membrane stress response:

  • YidC2 may participate in membrane remodeling during antibiotic-induced stress

  • Altered YidC2 function could contribute to adaptive responses that modify membrane composition under antimicrobial pressure

  • Changes in membrane protein insertase activity may affect cell envelope integrity in ways that impact antibiotic penetration

• Potential as antimicrobial target:

  • Essential membrane protein biogenesis pathways like those involving YidC2 represent potential targets for novel antimicrobials

  • Inhibitors of YidC2 function could synergize with existing antibiotics by preventing proper assembly of resistance determinants

  • Understanding species-specific features of Listeria YidC2 could enable selective targeting

Recent studies of multi-drug resistant L. innocua isolates containing plasmids like pLI42, pLI203, and pLI47-1 with resistance islands suggest that membrane protein machinery may play an underappreciated role in the acquisition and expression of resistance determinants . The findings that L. innocua can act as a gene sink for antimicrobial resistance determinants raises questions about how membrane protein biogenesis systems like YidC2 adapt to accommodate newly acquired resistance proteins.

What is the relationship between YidC2 and virulence in Listeria species?

The relationship between YidC2 and virulence in Listeria species involves complex interactions between membrane protein biogenesis and pathogenicity determinants:

• Integration of virulence factors:

  • YidC2 likely facilitates membrane insertion of certain virulence-associated proteins

  • Proper localization of adhesins, invasins, and secretion system components may depend on YidC2 function

  • The efficiency of YidC2-mediated insertion could influence virulence factor abundance and activity

• Pathogenicity island expression:

  • Recent research has identified listeria pathogenicity island-4 (LIPI-4) in L. innocua isolates, which is linked to central nervous system infection capacity in L. monocytogenes

  • The presence of LIPI-4 encoded proteins may require specific membrane protein insertases like YidC2 for proper expression

  • Phylogenetic analysis suggests LIPI-4 may have common origins between L. innocua and L. monocytogenes, raising questions about co-evolution with membrane biogenesis systems

• Stress adaptation during infection:

  • YidC2 may contribute to membrane remodeling under host-imposed stresses

  • Adaptation to intracellular environments likely requires changes in membrane protein composition

  • Environmental sensing systems embedded in membranes could depend on YidC2 for proper function

• Species-specific considerations:

  • While L. innocua is generally considered non-pathogenic, the presence of pathogenicity islands raises questions about potential virulence evolution

  • Comparison of YidC2 function between L. innocua and pathogenic L. monocytogenes could reveal specializations related to virulence

  • The potential for horizontal transfer of both virulence determinants and membrane biogenesis genes suggests possible coordinated evolution

Interestingly, the finding that MDR L. innocua isolates harbor LIPI-4 suggests that seemingly non-pathogenic species may serve as reservoirs for virulence determinants, with membrane protein biogenesis systems like YidC2 potentially facilitating their functional integration upon transfer to pathogenic species . The co-occurrence of antimicrobial resistance determinants with virulence factors in these isolates presents further complexity in understanding the role of membrane insertases in bacterial adaptation and pathogenicity.

How can structural knowledge of YidC2 inform the development of novel antimicrobial strategies?

Structural insights into YidC2 from Listeria innocua can drive novel antimicrobial strategies through several approaches:

• Structure-based inhibitor design:

  • Identification of substrate binding pockets within YidC2 structure

  • Computational screening of compound libraries against these binding sites

  • Development of small molecules that competitively inhibit YidC2-substrate interactions

  • Design of peptidomimetics that disrupt critical YidC2 functional domains

• Membrane insertase selectivity:

  • Comparative structural analysis between bacterial YidC2 and mammalian homologs (e.g., Oxa1)

  • Targeting bacterial-specific structural features to minimize host toxicity

  • Focusing on regions with low sequence conservation but high structural importance

  • Exploitation of differences in lipid interactions between bacterial and mammalian insertases

• Combination therapy approaches:

  • Identification of synergistic targets in membrane protein biogenesis pathways

  • Development of dual-targeting compounds affecting both YidC2 and Sec translocon

  • Creation of molecules that simultaneously disrupt insertase function and membrane integrity

  • Design of antimicrobial peptides that both target YidC2 and permeabilize bacterial membranes

• Structural vulnerabilities table:

  YidC2 Structural Feature	Potential Targeting Strategy	Antimicrobial Mechanism
  Substrate binding groove	Competitive inhibitors	Prevent essential protein insertion
  Membrane-water interface	Amphipathic peptides	Disrupt membrane interactions
  Oligomerization domains	Protein-protein interaction disruptors	Prevent functional complex formation
  Species-specific loops	Selective binding compounds	Target Listeria-specific features
  Conserved functional residues	Active site inhibitors	Block catalytic functions

• Novel delivery strategies:

  • Liposome-encapsulated YidC2 inhibitors for enhanced membrane targeting

  • Bacteriophage-based delivery of YidC2-inhibitory compounds

  • Nanoparticle formulations to improve penetration of bacterial biofilms

  • Conjugation to siderophores for bacterial-specific uptake mechanisms

The amino acid sequence of Listeria innocua YidC2 provides crucial information for structural modeling and identification of potential druggable sites . With the increasing concern about antimicrobial resistance in Listeria species, including multi-drug resistant L. innocua that may transfer resistance determinants to pathogenic species , developing novel antimicrobials targeting essential membrane biogenesis machinery like YidC2 represents a promising alternative approach to conventional antibiotics.

What are the most significant knowledge gaps in our understanding of YidC2 in Listeria innocua?

Despite advances in characterizing membrane protein insertases, significant knowledge gaps remain regarding YidC2 in Listeria innocua:

• Substrate specificity determinants: The molecular basis for substrate recognition by Listeria YidC2 remains poorly defined. Understanding which specific membrane proteins depend exclusively on YidC2 versus those that can utilize alternative insertion pathways is critical for comprehending its physiological role. Systematic identification of YidC2-dependent substrates through techniques like quantitative proteomics in YidC2-depleted cells would address this gap .

• Structural dynamics during insertion: While amino acid sequences of YidC2 are available , high-resolution structural information during the actual membrane insertion process is lacking. Time-resolved structural studies using techniques like cryo-electron microscopy or hydrogen-deuterium exchange mass spectrometry would illuminate the conformational changes that occur during substrate engagement and insertion.

• Regulatory mechanisms: How YidC2 expression and activity are regulated in response to environmental stresses, antimicrobial exposure, or during different growth phases remains unclear. Transcriptomic and proteomic studies comparing YidC2 levels under various conditions would identify potential regulatory mechanisms that could be exploited for antimicrobial development.

• Evolutionary relationships: Despite evidence suggesting horizontal gene transfer potential of virulence and resistance determinants between Listeria species , the evolutionary history of YidC2 and its potential co-transfer with pathogenicity islands requires further investigation. Comparative genomic analyses across broader bacterial taxa would clarify these relationships.

• Functional redundancy: The degree of functional overlap between YidC1 and YidC2 in Listeria species remains incompletely characterized. Understanding the specific contributions of each paralog to membrane protein biogenesis, especially under different environmental conditions, would provide insights into bacterial adaptation mechanisms.

Addressing these knowledge gaps would not only advance fundamental understanding of membrane protein biogenesis in Listeria species but also potentially reveal new approaches for antimicrobial development targeting these essential pathways.