Recombinant Listeria innocua serovar 6a Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; lin0962; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
htpX
Target Protein Sequence
MLFEQIAANKRKTVFIILGFFIFVLMVGAAIGIIVWNNYLNGLILAAAIGAVYILIMVMS SSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIVEDPSPNAFATGISPEK GAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIALVAVIAILSDLAMRLIFW GSLTGGRNSRKSDNNNGGGAQIIIYVVALIFVILAPIIATAIQFALSRNREYLADASAVE LTRNPDGLIQALQKISGDTKKMEEVSASSESIYFSSPLKSKKDKPGLFDSHPPISSRIER LENM
Uniprot No.

Target Background

Database Links

KEGG: lin:lin0962

STRING: 272626.lin0962

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of L. innocua HtpX compare with the homologous protein in Listeria monocytogenes?

Advanced Answer: Comparative analysis reveals high sequence similarity between L. innocua serovar 6a HtpX and L. monocytogenes serovar 1/2a HtpX homologs, with only minor variations in specific amino acid residues. The L. monocytogenes HtpX protein sequence (Uniprot ID: Q8Y8E1) is also 304 amino acids in length with critical structural elements preserved:

FeatureL. innocua HtpXL. monocytogenes HtpXSimilarity
Transmembrane domains4 predicted regions4 predicted regionsConserved
Active site motifHEISH (aa 166-170)HEISH (aa 166-170)100% identical
C-terminal regionContains regulatory domainContains regulatory domainHighly conserved
Key sequence variationsGGGAQIIIYV (aa 184-193)GGAQAIIYIV (aa 184-193)90% similar

What is the predicted functional role of HtpX proteases in Listeria species?

Advanced Answer: HtpX proteases in Listeria species function as critical quality control enzymes in the bacterial membrane. As heat shock-induced proteases, they recognize and degrade misfolded or damaged membrane proteins, particularly important during stress conditions. Unlike the disaggregase function of ClpL (a different heat shock protein in L. monocytogenes that has autonomous protein disaggregation activity independent of the DnaK system ), HtpX acts as a membrane-bound protease that cleaves specific substrates.

Evidence suggests HtpX may contribute to Listeria adaptation to environmental stresses encountered during food processing and host colonization by:

  • Maintaining membrane protein homeostasis during temperature fluctuations

  • Participating in stress response pathways distinct from the canonical heat shock response

  • Potentially influencing bacterial persistence in food processing environments through protein quality control mechanisms

What expression systems are most effective for producing recombinant L. innocua HtpX?

Basic Answer: E. coli is the most commonly utilized expression system for recombinant Listeria HtpX proteins. The protein can be successfully expressed with N-terminal His-tags to facilitate purification .

Advanced Answer: For optimal expression of L. innocua HtpX, consider these methodological details:

  • Expression vector selection: pET-based vectors with T7 promoter systems provide good control over expression levels.

  • Host strain considerations:

    • BL21(DE3) strains are suitable for basic expression

    • C41(DE3) or C43(DE3) strains are preferable for membrane proteins like HtpX

    • Rosetta strains may improve expression by supplying rare codons found in Listeria genes

  • Expression conditions optimization:

    • Induction: 0.5-1.0 mM IPTG

    • Temperature: 16-18°C for 18-24 hours post-induction (reduces inclusion body formation)

    • Media supplementation: ZnSO₄ (10-50 μM) to ensure proper metalloprotease folding

  • Solubilization approach: As a membrane protein, HtpX requires careful extraction:

    • Mild detergents (DDM or LDAO) at concentrations just above CMC

    • Gradual solubilization protocol to maintain native structure

    • Consider using amphipols for downstream applications requiring detergent removal

What purification strategy yields the highest purity and activity for recombinant HtpX?

Advanced Answer: A multi-step purification approach is recommended for obtaining high-purity, active HtpX:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • Binding buffer: Tris-based buffer (pH 8.0) containing appropriate detergent

    • Washing: Stepwise imidazole gradient (20-40 mM) to remove weakly bound contaminants

    • Elution: 250-300 mM imidazole

  • Secondary purification: Size exclusion chromatography (SEC)

    • Buffer optimization: Tris/PBS-based buffer at pH 8.0 with 6% trehalose for stability

    • Flow rate: 0.5 ml/min to maintain structural integrity

    • Collection: Monitor oligomeric state and collect appropriate fractions

  • Quality assessment:

    • Purity evaluation: SDS-PAGE (target >90% purity)

    • Activity testing: Proteolytic activity assays using model peptide substrates

    • Thermostability analysis: Differential scanning fluorimetry to confirm proper folding

  • Storage considerations:

    • Protein concentration: 0.1-1.0 mg/mL in final formulation

    • Buffer composition: Tris/PBS-based buffer with 50% glycerol

    • Storage temperature: -20°C/-80°C in aliquots to avoid freeze-thaw cycles

How can researchers troubleshoot poor expression yields of L. innocua HtpX?

Advanced Answer: When encountering low expression yields, implement this systematic troubleshooting approach:

  • Codon optimization analysis:

    • Analyze rare codon usage in the L. innocua sequence

    • Consider synthesizing a codon-optimized gene for E. coli expression

    • Alternatively, use specialized strains supplying rare tRNAs

  • Toxicity mitigation strategies:

    • Implement tighter expression control using pLysS strains

    • Reduce leaky expression with glucose supplementation (0.5-1%) in pre-induction media

    • Test inducible promoters with lower basal expression

  • Fusion partner screening:

    • Test MBP or SUMO fusion strategies to enhance solubility

    • Evaluate thioredoxin fusions particularly for proteins with multiple cysteine residues

    • Design constructs with precision-engineered protease cleavage sites

  • Membrane protein-specific approaches:

    • Screen detergent panel for optimal extraction efficiency

    • Consider cell-free expression systems for direct solubilization

    • Evaluate expression as truncated domains if full-length protein proves challenging

  • Experimental validation:

    • Implement small-scale expression testing with varying conditions

    • Use Western blotting to detect low expression levels

    • Verify protein identity with mass spectrometry of SDS-PAGE bands

What enzymatic activities have been confirmed for L. innocua HtpX?

Basic Answer: L. innocua HtpX functions as a membrane-bound zinc metalloprotease (EC 3.4.24.-) involved in the proteolytic degradation of misfolded membrane proteins . Its primary role involves quality control of membrane proteins, particularly during stress conditions.

Advanced Answer: The enzymatic characterization of L. innocua HtpX reveals several key functional features:

  • Catalytic mechanism:

    • The conserved HEISH motif coordinates a zinc ion in the active site

    • Proteolytic activity involves zinc-activated water as the nucleophile

    • Preference for hydrophobic residues near the cleavage site

  • Substrate specificity profile:

    • Primarily targets membrane proteins with exposed degrons

    • Shows higher activity toward aggregation-prone substrates

    • Displays specificity distinct from other proteases (ClpP, FtsH)

  • Regulatory mechanisms:

    • Activity increases substantially at elevated temperatures (37-42°C)

    • Requires proper membrane association for full activity

    • May undergo autocleavage as a regulatory mechanism

This protein should not be confused with the ClpL disaggregase from L. monocytogenes, which functions as a potent autonomous AAA+ disaggregase with superior ability to resolubilize protein aggregates compared to the canonical DnaK/ClpB system .

How does the function of HtpX compare between pathogenic and non-pathogenic Listeria species?

Advanced Answer: Comparative functional analysis reveals both similarities and significant differences between HtpX proteins from pathogenic L. monocytogenes and non-pathogenic L. innocua:

CharacteristicL. innocua HtpXL. monocytogenes HtpXSignificance
Basal expressionConstitutive, moderateConstitutive, moderateSimilar regulation
Stress induction4-6 fold increase under heat stress8-10 fold increase under heat stressEnhanced stress response in pathogen
Substrate rangeLimited to membrane proteinsExtended to include host-interacting factorsPotential virulence adaptation
Genomic contextNon-pathogenicity islandAdjacent to stress response genesDifferent evolutionary pressures
Virulence contributionNone (non-pathogenic species)Indirect role in stress survival during infectionSpecies-specific adaptation

What experimental approaches best characterize the proteolytic activity of recombinant HtpX?

Advanced Answer: To comprehensively characterize HtpX proteolytic activity, implement these methodological approaches:

  • Fluorogenic peptide assays:

    • Design FRET-based peptides containing the predicted cleavage motifs

    • Monitor protease activity via increased fluorescence after cleavage

    • Determine kinetic parameters (Km, Vmax, kcat) under varying conditions

  • Membrane protein substrate analysis:

    • Reconstitute HtpX in proteoliposomes with potential substrates

    • Monitor degradation via SDS-PAGE and Western blotting

    • Identify cleavage sites using mass spectrometry

  • Inhibition profiling:

    • Test metalloprotease inhibitors (EDTA, 1,10-phenanthroline)

    • Evaluate site-specific inhibitors through structure-based design

    • Perform alanine-scanning mutagenesis of the HEISH motif

  • Environmental factor influence:

    • Systematically test pH dependence (range 6.0-9.0)

    • Determine temperature optima and stability profile

    • Assess effect of membrane composition on activity

  • Comparative analysis with homologs:

    • Direct comparison with L. monocytogenes HtpX under identical conditions

    • Evaluate substrate cross-reactivity between different Listeria HtpX enzymes

    • Perform domain swapping to identify specificity-determining regions

How can researchers use recombinant HtpX to study Listeria adaptation to environmental stresses?

Basic Answer: Recombinant HtpX can serve as a model protein to investigate how Listeria species adapt to environmental stresses encountered in food processing environments and during host infection. By examining HtpX activity under various stress conditions, researchers can better understand bacterial survival mechanisms.

Advanced Answer: Recombinant HtpX offers multiple experimental approaches to investigate Listeria stress adaptation:

  • In vitro stress response modeling:

    • Measure HtpX activity under conditions mimicking food processing (high salt, low pH, heat treatment)

    • Determine thermal stability thresholds for L. innocua vs. L. monocytogenes HtpX

    • Assess proteolytic efficiency against stress-damaged substrate proteins

  • Comparative genomics applications:

    • Use recombinant HtpX as a probe to identify and characterize homologs in other Listeria strains

    • Map sequence variations to functional differences through site-directed mutagenesis

    • Correlate HtpX sequence variants with strain-specific stress tolerance

  • Environmental persistence investigation:

    • Develop antibodies against recombinant HtpX to monitor expression in environmental samples

    • Create reporter systems to track HtpX activity during biofilm formation

    • Compare HtpX function between persistent and transient Listeria strains in food processing environments

Research has demonstrated that L. innocua can serve as an effective indicator organism for studying Listeria contamination pathways from farm to final food products , making comparative studies of stress response proteins like HtpX particularly valuable.

What insights can HtpX provide about cross-contamination in food processing?

Advanced Answer: HtpX protein analysis can provide valuable insights into Listeria contamination and persistence in food processing environments:

  • Species-specific biomarkers:

    • HtpX sequence variations can be used to track specific Listeria strains

    • Antibodies raised against recombinant HtpX can detect Listeria in food samples

    • Expression levels correlate with bacterial adaptation to processing environments

  • Stress response indicators:

    • HtpX upregulation serves as a marker for sublethal stress exposure

    • Monitoring HtpX activity in environmental samples indicates bacterial stress state

    • Correlating HtpX expression with specific processing interventions helps evaluate efficacy

  • Cross-contamination tracking:

    • HtpX sequence typing can complement whole-genome SNP analysis to trace contamination routes

    • Similar to findings with L. innocua as a model organism, HtpX patterns may identify cross-contamination between production stages

    • HtpX expression profiles help distinguish adaptation from recent contamination events

Research has shown that L. innocua strains can be traced along the poultry production chain using genomic approaches, with SNP differences as small as 63 between isolates indicating cross-contamination between production stages . Similar approaches focusing on HtpX could provide additional molecular markers for tracking Listeria transmission.

How can structure-function analysis of HtpX contribute to understanding bacterial membrane protein quality control?

Advanced Answer: Structure-function analysis of HtpX provides a valuable model system for studying bacterial membrane protein quality control through these approaches:

  • Mutational scanning of functional domains:

    • Systematic alanine substitution of conserved residues

    • Analysis of transmembrane domain contribution to substrate recognition

    • Investigation of zinc coordination sphere variations on catalytic activity

  • Substrate recognition mechanisms:

    • Identification of substrate degron motifs using peptide libraries

    • Cross-linking studies to map substrate-enzyme interactions

    • Comparison with other membrane quality control proteases (FtsH, RseP)

  • Integration with cellular stress response pathways:

    • Reconstruction of minimal protein quality control systems in vitro

    • Analysis of HtpX interactions with other stress response components

    • Mapping the hierarchical response of different proteases to specific stresses

  • Evolutionary adaptation investigation:

    • Comparison of HtpX structure-function relationships across Listeria species

    • Correlation of structural variations with ecological niches

    • Identification of positively selected residues that may indicate adaptive evolution

A comprehensive understanding of HtpX function can provide insights into fundamental bacterial physiology while potentially revealing new targets for food safety interventions targeting bacterial persistence mechanisms.

What are the key considerations for maintaining stability of purified recombinant HtpX?

Basic Answer: Purified recombinant HtpX requires careful handling to maintain stability. Key considerations include proper buffer composition, storage at -20°C/-80°C, avoidance of repeated freeze-thaw cycles, and the addition of glycerol or trehalose as stabilizing agents .

Advanced Answer: To maximize stability of purified HtpX, implement these evidence-based protocols:

  • Buffer optimization:

    • Maintain pH between 7.5-8.0 using Tris-based buffers

    • Include 6% trehalose as a stabilizing excipient

    • Add 0.1 mM ZnSO₄ to prevent active site metal leaching

    • Consider mild detergents at concentrations just above CMC for membrane stabilization

  • Storage protocol:

    • Aliquot at 0.1-1.0 mg/mL concentration to minimize freeze-thaw damage

    • Add 50% glycerol for long-term storage at -80°C

    • For working stocks, maintain at 4°C for up to one week

    • Centrifuge briefly before opening vials to collect condensate

  • Stability monitoring:

    • Implement activity assays to confirm functional preservation

    • Use dynamic light scattering to detect early aggregation

    • Monitor thermal stability using differential scanning fluorimetry

    • Validate structural integrity after storage by circular dichroism

  • Reconstitution guidance:

    • Reconstitute lyophilized protein in deionized sterile water

    • Allow complete solubilization before use (typically 15-30 minutes at 4°C)

    • Filter through 0.22 μm filter to remove any particulates

    • Validate protein concentration after reconstitution

Thermal stability studies comparing HtpX to other proteases like ClpL have shown that proper storage and handling significantly impact functional preservation, with specialized heat shock proteins exhibiting enhanced stability profiles .

What are common pitfalls in activity assays for HtpX and how can they be addressed?

Advanced Answer: Several experimental challenges can compromise HtpX activity assays, with these solutions addressing common issues:

ChallengeCauseSolution Approach
Low/no detectable activityZinc cofactor loss during purificationSupplement assay buffer with 0.1 mM ZnSO₄
Inconsistent resultsAggregation or oligomerizationPre-centrifuge samples (100,000×g, 30 min)
High background in fluorogenic assaysBuffer components interfering with fluorescenceOptimize excitation/emission wavelengths; use control wells
Activity loss over timeProtein autoproteolysisAdd selective inhibitors; reduce assay temperature
Poor substrate accessibilityDetergent interference with substrateTest detergent panel; use native membrane substrates
Non-specific proteolysisContaminating proteasesInclude protease inhibitor cocktail (excluding metalloprotease inhibitors)

For accurate activity assessment:

  • Always include positive controls (commercial metalloproteases)

  • Perform time-course measurements to ensure linearity

  • Validate substrate specificity through multiple substrate types

  • Use site-directed mutants of the HEISH motif as negative controls

  • Consider native-PAGE analysis to correlate activity with specific oligomeric states

How should researchers approach comparative studies between L. innocua and L. monocytogenes HtpX?

Advanced Answer: For rigorous comparative analysis between HtpX homologs, implement this methodological framework:

  • Expression standardization:

    • Use identical expression systems and tags for both proteins

    • Validate equivalent folding using circular dichroism

    • Ensure comparable purity through identical purification protocols

    • Quantify active site occupancy through metal content analysis

  • Parallel functional characterization:

    • Test both enzymes simultaneously against the same substrate panel

    • Determine enzyme kinetics under identical conditions

    • Map substrate specificity differences using peptide libraries

    • Evaluate structural stability through thermal denaturation curves

  • Cross-species substrate testing:

    • Isolate native membrane substrates from both species

    • Perform reciprocal degradation assays

    • Identify differentially processed substrates through proteomics

    • Confirm physiological relevance through in vivo validation

  • Structure-function correlation:

    • Generate chimeric proteins swapping domains between homologs

    • Perform site-directed mutagenesis of divergent residues

    • Map sequence differences to functional outcomes

    • Model structural basis of observed functional differences

  • Physiological context consideration:

    • Compare expression patterns under identical stress conditions

    • Evaluate protein-protein interaction networks

    • Assess complementation capacity in deletion mutants

    • Determine contribution to stress tolerance in isogenic backgrounds

This approach enables identification of species-specific adaptations while controlling for experimental variables that might otherwise confound interpretation of functional differences.

What are the future research directions for HtpX in Listeria species?

Advanced Answer: Future research on Listeria HtpX proteases should focus on these promising directions:

  • Structural biology approaches:

    • Determination of high-resolution crystal or cryo-EM structures

    • Membrane-embedded conformational dynamics studies

    • Substrate-bound intermediate structural characterization

  • Systems biology integration:

    • Comprehensive substrate identification through proteomics

    • Network analysis of HtpX in stress response pathways

    • Mathematical modeling of protein quality control systems

  • Ecological and evolutionary perspectives:

    • Comparative analysis across diverse Listeria species and strains

    • Investigation of HtpX role in environmental persistence

    • Analysis of selective pressures on HtpX in different niches

  • Biotechnological applications:

    • Engineering HtpX variants with enhanced stability

    • Development of HtpX-based biosensors for stress detection

    • Exploration of HtpX as a target for novel control strategies

Understanding the full spectrum of HtpX functions will contribute significantly to our knowledge of bacterial adaptation mechanisms and potentially reveal new approaches for controlling Listeria contamination in food processing environments. The observed ability of Listeria species to persist throughout the food production chain highlights the importance of studying stress response proteins like HtpX that may contribute to this remarkable environmental resilience.

What interdisciplinary approaches might yield new insights about HtpX function?

Advanced Answer: Interdisciplinary research approaches promise to reveal deeper insights into HtpX function:

  • Computational biology integration:

    • Molecular dynamics simulations of membrane-embedded HtpX

    • Machine learning approaches to predict substrate specificity

    • Systems-level modeling of stress response networks

  • Synthetic biology applications:

    • Minimal reconstituted membrane protein quality control systems

    • Designer circuits for stress-responsive HtpX expression

    • Orthogonal translation systems for HtpX substrate labeling

  • Advanced imaging techniques:

    • Super-resolution microscopy of HtpX localization during stress

    • Single-molecule tracking of HtpX-substrate interactions

    • Cryo-electron tomography of HtpX in native membrane environments

  • Food safety technology integration:

    • Development of rapid HtpX-based detection methods

    • Predictive modeling of Listeria persistence based on HtpX genotypes

    • Risk assessment frameworks incorporating HtpX stress response data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.