Recombinant Listeria innocua serovar 6a Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Protein Identification

Recombinant Listeria innocua serovar 6a Protein CrcB homolog 1 (crcB1) is identified in the UniProt database with the accession number Q929T7 . The protein is encoded by the crcB1 gene, with the ordered locus name lin2187 in the Listeria innocua serovar 6a strain CLIP 11262 genome . This protein belongs to the CrcB protein family, which is widely distributed across bacterial species and plays critical roles in ion transport across cell membranes.

Putative Fluoride Ion Transport

The CrcB homolog 1 protein in Listeria species is annotated as a putative fluoride ion transporter . Fluoride ion transporters play critical roles in bacterial resistance to environmental fluoride, which can be toxic to cells at certain concentrations. The protein functions by facilitating the export of fluoride ions from the cellular cytoplasm, thereby maintaining internal ion homeostasis and protecting essential metabolic enzymes from fluoride inhibition.

Evolutionary Conservation

The significant sequence similarity between CrcB homologs across different Listeria species suggests evolutionary conservation of this protein's function. The CrcB family is widely distributed across bacterial genera, indicating its fundamental importance in bacterial physiology and environmental adaptation. In Listeria species, the genome typically encodes two CrcB homologs (CrcB1 and CrcB2), which may provide functional redundancy or specialized roles in different environmental conditions.

Expression Systems and Purification

The Recombinant Listeria innocua serovar 6a Protein CrcB homolog 1 (crcB1) is typically produced using E. coli expression systems, similar to the approach used for homologous proteins from L. monocytogenes . The recombinant protein may include fusion tags to facilitate purification and detection, with the specific tag type determined during the production process . When expressed in E. coli, the protein can be extracted, purified, and formulated into a stable preparation for research applications.

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant L. innocua CrcB1 Protein

PropertySpecification
SpeciesListeria innocua serovar 6a (strain CLIP 11262)
UniProt IDQ929T7
Expression Region1-118 (full length)
Molecular Weight~13 kDa (estimated)
FormulationTypically in Tris-based buffer with 50% glycerol
Storage Conditions-20°C for standard storage; -80°C for extended storage
StabilityWorking aliquots stable at 4°C for up to one week
Special HandlingRepeated freeze-thaw cycles not recommended

The recombinant protein is typically supplied as a solution optimized for stability and functionality, with recommendations for proper storage and handling to maintain its structural integrity and biological activity .

Comparison with L. monocytogenes CrcB Homologs

Listeria monocytogenes expresses two CrcB homologs, designated as CrcB1 and CrcB2. The CrcB1 protein from L. monocytogenes serovar 1/2a (Q8Y5I1) shares significant sequence similarity with the L. innocua CrcB1 protein, indicating functional conservation . The CrcB2 protein (Q8Y5I0) is slightly larger at 129 amino acids and shows distinct sequence variations, suggesting potential functional specialization between the two homologs .

Table 2: Comparison of CrcB Homologs in Listeria Species

FeatureL. innocua CrcB1L. monocytogenes CrcB1L. monocytogenes CrcB2
UniProt IDQ929T7Q8Y5I1Q8Y5I0
Length118 aa118 aa129 aa
Gene Locuslin2187lmo2081lmo2082
FunctionPutative fluoride ion transporterPutative fluoride ion transporterPutative fluoride ion transporter
Sequence Similarity to L. innocua CrcB1100%High (estimated >90%)Moderate (estimated 70-80%)

Functional Implications of Sequence Variations

The sequence variations between CrcB homologs may reflect adaptations to different environmental niches or physiological requirements. While the core function of fluoride ion transport is likely conserved across these proteins, subtle differences in amino acid composition could influence properties such as ion selectivity, transport efficiency, and regulatory control. The presence of two homologs (CrcB1 and CrcB2) in Listeria genomes suggests potential functional specialization or redundancy that may contribute to the organism's adaptation capabilities.

Immunological Applications

As a bacterial protein, Recombinant L. innocua CrcB1 can be utilized in immunological research, including:

  • Generation of specific antibodies for protein detection and localization

  • Development of immunoassays for Listeria species identification

  • Investigation of host immune responses to bacterial membrane proteins

Biotechnological Potential

The ion transport capabilities of CrcB proteins present potential biotechnological applications:

  • Development of biosensors for fluoride detection

  • Engineering of bacteria with enhanced resistance to environmental toxins

  • Design of membrane protein-based filtration or purification systems

Listeria innocua as a Non-Pathogenic Model

Listeria innocua is generally considered non-pathogenic and serves as an important comparative model for understanding the molecular basis of pathogenicity in the closely related L. monocytogenes . While both species share substantial genomic content, including conserved housekeeping genes such as crcB1, L. innocua typically lacks the major virulence determinants present in L. monocytogenes.

Evolutionary Insights from Comparative Genomics

Comparative analysis of proteins like CrcB1 across Listeria species provides insights into the evolutionary relationships and adaptive processes within this bacterial genus. The high conservation of CrcB homologs suggests their fundamental importance in bacterial physiology, predating the evolutionary divergence of pathogenic and non-pathogenic Listeria species.

Quality Control Considerations

Commercial preparations of recombinant proteins typically undergo quality control testing to ensure:

  • Purity (typically >90% as determined by SDS-PAGE)

  • Identity confirmation (typically by mass spectrometry or immunological methods)

  • Proper folding and structural integrity

  • Absence of contaminating proteins or endotoxins

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes for personalized preparation.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain their stability for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
crcB1; lin2187; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
crcB1
Target Protein Sequence
MLINFLLVGFGASLGAMLRYGISIFVKSKWKTDFPYATFFINITGSFLLGFLVSTALGPM WQLFLGTGFMGGYTTFSTFKVESMELKWKANFQVLFSYVGLTYLCGLIAAFIGIMLGV
Uniprot No.

Target Background

Function
CrcB1 plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxic effects.
Database Links

KEGG: lin:lin2187

STRING: 272626.lin2187

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of crcB1 in Listeria innocua serovar 6a?

The crcB1 gene in Listeria innocua exists within the genomic context similar to other Listeria species. Comparative genomic analyses show that L. innocua and L. monocytogenes share a high degree of proteome homology (approximately 92.45%), suggesting similar genomic organization . The crcB1 gene is part of the core genome in Listeria species, and its position is likely conserved across different strains. In L. monocytogenes, orthologous genes are found in L. innocua genomes at the same relative positions, highlighting evolutionary conservation .

When planning genomic studies of crcB1, researchers should consider:

  • Utilizing comparative genomic approaches to identify conserved regions

  • Examining neighboring genes for potential operonic structures

  • Investigating promoter elements that might regulate crcB1 expression

  • Analyzing sequence variations across different Listeria strains to identify functional domains

What is the amino acid sequence and predicted structure of Listeria innocua crcB1 protein?

While the exact amino acid sequence of L. innocua crcB1 is not provided in the available data, we can compare it with homologous proteins. For instance, the CrcB homolog 1 from Prochlorococcus marinus consists of 109 amino acids , while the Mycobacterium paratuberculosis homolog consists of 132 amino acids . Based on homology patterns in Listeria species, the L. innocua crcB1 would likely have a length between 110-140 amino acids.

The predicted structure would include:

  • Multiple transmembrane domains typical of ion transporters

  • Conserved motifs for fluoride ion binding and transport

  • Structural features consistent with membrane protein topology

For structural predictions, researchers should employ:

  • In silico structural modeling using homologous proteins as templates

  • Hydropathy analysis to identify transmembrane regions

  • Conservation analysis across multiple species to identify functional domains

How can I design primers for amplifying the crcB1 gene from Listeria innocua serovar 6a?

For efficient amplification of the crcB1 gene from L. innocua serovar 6a, consider the following methodological approach:

  • Obtain the reference sequence of crcB1 from L. innocua genome databases

  • Design primers with the following characteristics:

    • 18-25 nucleotides in length

    • 40-60% GC content

    • Melting temperatures between 55-65°C

    • Limited secondary structure and self-complementarity

  • Add restriction sites to the 5' ends of primers for subsequent cloning (e.g., XbaI and NotI as used in similar Listeria studies)

  • Include 3-6 extra nucleotides upstream of restriction sites to facilitate efficient enzyme cutting

PCR conditions should be optimized with:

  • Initial denaturation at 95°C for 5 minutes

  • 30-35 cycles of: denaturation (94°C, 30s), annealing (55-60°C, 30s), extension (72°C, 1 min/kb)

  • Final extension at 72°C for 10 minutes

The specificity of primers should be verified by BLAST analysis against the L. innocua genome to avoid non-specific amplification.

What expression systems are most effective for recombinant Listeria innocua crcB1 protein production?

Based on successful approaches with homologous proteins, E. coli represents the most effective heterologous expression system for recombinant L. innocua crcB1 protein production . The methodology should include:

  • Vector selection: pET series vectors with T7 promoter systems offer high-level expression

  • E. coli strain selection: BL21(DE3) or Rosetta strains are preferable for membrane proteins

  • Fusion tag incorporation: N-terminal His-tag facilitates purification and detection

  • Expression conditions optimization:

    • Induction at OD600 0.6-0.8 with 0.1-1.0 mM IPTG

    • Reduced temperature (16-25°C) for proper protein folding

    • Extended expression time (16-20 hours) for membrane proteins

For membrane proteins like crcB1, consider:

  • Using specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Adding glycerol (5-10%) to culture media to stabilize membrane proteins

  • Employing mild detergents during extraction and purification

What purification strategies yield the highest purity and activity for recombinant crcB1 protein?

For optimal purification of recombinant His-tagged L. innocua crcB1, a multi-step approach is recommended:

  • Cell lysis optimization:

    • For membrane proteins, use mild detergents (DDM, LDAO, or OG at 1-2%)

    • Include protease inhibitors to prevent degradation

    • Use buffer systems at pH 7.5-8.0 containing 100-300 mM NaCl

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA or Co-NTA resins with imidazole gradients (10-250 mM)

    • Include detergent at concentrations above CMC but below 2x CMC

    • Elute with 250-500 mM imidazole

  • Size exclusion chromatography:

    • Use Superdex 200 or similar for final polishing

    • Buffer composition: Tris/PBS-based buffer, pH 8.0 with detergent

  • Storage considerations:

    • Add 6% trehalose as a stabilizing agent

    • Store at -20°C/-80°C in aliquots to avoid freeze-thaw cycles

    • Consider adding glycerol (5-50%) for long-term storage

Typical purity achieved should be >90% as determined by SDS-PAGE .

How can I verify the proper folding and functionality of purified recombinant crcB1 protein?

Verification of proper folding and functionality requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to assess compact folding

  • Functional validation (for putative fluoride ion transporter):

    • Fluoride ion binding assays using fluorescence quenching

    • Liposome reconstitution with fluoride-sensitive probes

    • Isothermal titration calorimetry (ITC) for binding affinity determination

  • Biophysical characterization:

    • Dynamic light scattering to assess monodispersity

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation for oligomeric state determination

For membrane proteins like crcB1, reconstitution into lipid environments (nanodiscs, liposomes) may be necessary for function. Fluoride transport activity can be measured using fluoride-selective electrodes or fluorescent probes in reconstituted systems.

How does Listeria innocua crcB1 compare to homologs in pathogenic Listeria species?

Comparative analysis between L. innocua crcB1 and its homologs in pathogenic Listeria species reveals important evolutionary and functional insights:

FeatureL. innocua (non-pathogenic)L. monocytogenes (pathogenic)L. ivanovii (pathogenic)
Gene conservationPresentPresentPresent
Sequence similarityReference~92.45% homology with L. innocua Lower homology than L. monocytogenes
Genomic contextSimilar to L. monocytogenesSimilar to L. innocuaSome differences
Potential roleFluoride ion transportFluoride ion transportFluoride ion transport
Association with virulenceNo direct associationPotential indirect associationPotential indirect association

The high homology between L. innocua and L. monocytogenes proteins (>92%) suggests functional conservation despite differences in pathogenicity. When examining crcB1 specifically, researchers should focus on:

  • Single nucleotide polymorphisms that might alter protein function

  • Regulatory element differences affecting expression levels

  • Interactions with species-specific proteins

  • Differences in post-translational modifications

This comparison can provide insights into whether crcB1 contributes to environmental adaptation rather than pathogenicity.

What functional protein domains characterize the CrcB homolog family across bacterial species?

The CrcB homolog family across bacterial species shares several conserved functional domains:

  • Transmembrane domains: Typically 3-4 transmembrane helices forming a channel structure

  • Fluoride ion binding motifs: Conserved amino acid residues involved in F⁻ coordination

  • Oligomerization interfaces: Regions that facilitate dimer or tetramer formation

Based on the amino acid sequences provided for P. marinus and M. paratuberculosis CrcB homologs , the proteins contain hydrophobic stretches consistent with transmembrane domains. The sequences differ in length (109 aa vs. 132 aa) but likely maintain functional conservation.

Key functional motifs to examine include:

  • Conserved charged residues in transmembrane regions

  • Aromatic residues at membrane interfaces

  • Glycine-rich flexibility regions

Researchers investigating L. innocua crcB1 should perform multiple sequence alignments with diverse bacterial CrcB proteins to identify these conserved domains and predict functional regions.

How can phylogenetic analysis of crcB1 contribute to understanding Listeria species evolution?

Phylogenetic analysis of crcB1 can provide valuable insights into Listeria species evolution through several methodological approaches:

  • Multiple sequence alignment of crcB1 across all Listeria species

  • Tree construction using maximum likelihood or Bayesian methods

  • Calculation of selection pressures (dN/dS ratios) to identify evolutionary constraints

  • Ancestral sequence reconstruction to trace evolutionary changes

The close relationship between L. monocytogenes and L. innocua (~92.45% homologous proteome) suggests recent evolutionary divergence. Including crcB1 in genomic analyses can help:

  • Clarify the timing of pathogenic/non-pathogenic lineage separation

  • Identify horizontal gene transfer events influencing crcB1 evolution

  • Understand adaptation to different environmental niches

  • Correlate genetic conservation with functional importance

Since L. innocua and L. monocytogenes share many orthologous genes at the same relative positions , crcB1 phylogeny can be anchored in genome-wide evolutionary contexts to provide more robust evolutionary insights.

What methodologies are most effective for determining the ion transport function of crcB1 protein?

Determining the ion transport function of crcB1 protein, particularly its putative role as a fluoride ion transporter, requires specialized methodologies:

  • Reconstitution systems:

    • Proteoliposomes with purified crcB1 protein

    • Giant unilamellar vesicles (GUVs) for single-channel recordings

    • Planar lipid bilayers for electrophysiology

  • Transport assays:

    • Fluoride-selective electrode measurements of ion flux

    • Fluorescence-based assays using F⁻-sensitive probes

    • Isotope (¹⁸F) flux studies for direct transport quantification

  • Complementation approaches:

    • Expression in crcB-knockout bacterial strains

    • Growth assays under fluoride stress conditions

    • Competition assays between wild-type and mutant strains

  • Structural analysis:

    • Cryo-EM to determine channel architecture

    • X-ray crystallography with fluoride analogs

    • Molecular dynamics simulations of ion permeation

The methodological workflow should begin with in vitro reconstitution systems followed by validation in cellular contexts using genetic complementation.

How does gene knockout or mutation of crcB1 affect Listeria innocua physiology and stress response?

To investigate the effects of crcB1 knockout or mutation on L. innocua physiology, researchers should employ these methodological approaches:

  • Generation of crcB1 knockout strains:

    • Homologous recombination using targeting plasmids similar to those used for other Listeria genes

    • CRISPR-Cas9 mediated deletion

    • Verification by genome PCR and sequencing

  • Phenotypic characterization:

    • Growth curves under normal and stress conditions

    • Fluoride susceptibility testing at varying concentrations

    • Membrane potential measurements

    • pH homeostasis assessment

  • Comparative transcriptomics/proteomics:

    • RNA-seq to identify compensatory gene expression changes

    • Proteome analysis to detect altered protein abundances

    • Specific pathway analysis related to ion homeostasis

  • Complementation studies:

    • Reintroduction of wild-type crcB1

    • Introduction of crcB1 from other species

    • Structure-function analysis with point mutations

Expected phenotypes might include:

  • Increased sensitivity to fluoride

  • Altered growth kinetics under specific ionic conditions

  • Potential impacts on membrane properties and cell morphology

  • Compensatory upregulation of alternative ion transport systems

What role might crcB1 play in environmental adaptation of Listeria innocua?

The crcB1 protein likely plays a significant role in environmental adaptation of L. innocua through several mechanisms:

  • Fluoride detoxification:

    • Protection against naturally occurring fluoride in soil and water

    • Resistance to antimicrobial fluoride compounds

    • Maintenance of enzymatic function by preventing fluoride inhibition

  • pH adaptation:

    • Indirect contribution to pH homeostasis

    • Protection against acids that release fluoride ions

    • Synergy with other ion transport systems

  • Biofilm formation and persistence:

    • Potential role in surface attachment

    • Contribution to ionic balance within biofilm structures

    • Protection of community against environmental toxins

  • Food matrix survival:

    • Adaptation to food processing conditions

    • Resistance to sanitizers containing fluoride

    • Persistence under refrigeration stress

Research approaches should include:

  • Comparative analysis of crcB1 expression under different environmental conditions

  • Correlation between crcB1 sequence variations and isolation sources

  • Competition assays between wild-type and crcB1 mutants in simulated food environments

  • Biofilm formation assessments under varying fluoride concentrations

How can recombinant crcB1 be utilized for structural studies of fluoride ion channels?

Recombinant crcB1 offers a valuable model system for structural studies of fluoride ion channels through these methodological approaches:

  • Protein engineering for structural studies:

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Thermostabilizing mutations to enhance stability

    • Surface entropy reduction to promote crystal contacts

    • Nanobody generation for structure stabilization

  • Cryo-EM approaches:

    • Reconstitution in nanodiscs or amphipols

    • GraFix method for stabilizing oligomeric assemblies

    • Single particle analysis workflow optimization

    • Classification strategies for heterogeneous samples

  • X-ray crystallography:

    • Lipidic cubic phase (LCP) crystallization

    • Vapor diffusion with detergent screening

    • Heavy atom derivatization for phasing

    • Micro/meso-crystallization approaches

  • Complementary methods:

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) for dynamics

    • DEER spectroscopy for distance measurements

    • Solid-state NMR for local structure determination

The recombinantly expressed crcB1 should be optimized for homogeneity and stability, employing buffer systems containing 6% trehalose at pH 8.0 as reported for other CrcB homologs .

What insights can interspecies comparison of CrcB homologs provide about ion selectivity mechanisms?

Interspecies comparison of CrcB homologs can yield critical insights into ion selectivity mechanisms through:

  • Sequence analysis approaches:

    • Identification of conserved vs. variable residues across species

    • Correlation of sequence variations with habitat fluoride concentrations

    • Evolutionary tracing to identify functionally important residues

  • Structure-function studies:

    • Generation of chimeric proteins between different species

    • Site-directed mutagenesis of putative selectivity filter residues

    • Electrophysiological characterization of ion selectivity

  • Computational analyses:

    • Homology modeling based on related structures

    • Molecular dynamics simulations of ion permeation

    • Free energy calculations for ion binding and transport

  • Comparative functional assays:

    • Side-by-side transport assays with different CrcB homologs

    • Competition assays with different anions

    • pH-dependence profiles across homologs

The amino acid sequences available from P. marinus and M. paratuberculosis CrcB homologs provide starting points for identifying conserved regions that might constitute the selectivity filter for fluoride ions.

How can systems biology approaches integrate crcB1 function into broader Listeria stress response networks?

Systems biology approaches can contextualize crcB1 function within broader Listeria stress response networks through:

  • Multi-omics integration:

    • Transcriptomics under various stress conditions

    • Proteomics to identify interaction partners

    • Metabolomics to detect changes in fluoride-sensitive pathways

    • Fluxomics to measure metabolic adaptations

  • Network analysis methods:

    • Protein-protein interaction mapping

    • Regulatory network reconstruction

    • Bayesian network inference

    • Flux balance analysis with crcB1 constraints

  • Experimental validation approaches:

    • ChIP-seq to identify transcription factors regulating crcB1

    • RNA-seq of crcB1 mutants under stress conditions

    • Synthetic lethality screening

    • CRISPR interference for partial knockdown phenotypes

  • Mathematical modeling:

    • Ordinary differential equation models of ion homeostasis

    • Agent-based models of population responses

    • Constraint-based models of metabolic impacts

Integration of crcB1 into these networks should consider the genomic context and potential operonic structures, as orthologous genes between L. monocytogenes and L. innocua are often found at the same relative positions .

How can recombinant crcB1 be engineered for enhanced stability and activity in research applications?

Engineering recombinant crcB1 for enhanced stability and activity requires systematic protein engineering approaches:

  • Computational design strategies:

    • Rosetta-based stability prediction and optimization

    • Identification of destabilizing residues for mutation

    • Disulfide bond introduction at strategic positions

    • Surface entropy reduction for crystallization

  • Directed evolution methodologies:

    • Error-prone PCR to generate variant libraries

    • Selection under increasing fluoride concentrations

    • Deep mutational scanning for activity-stability relationships

    • Compartmentalized self-replication for functional screening

  • Fusion protein approaches:

    • N-terminal MBP or SUMO fusions for solubility

    • C-terminal stability tags

    • Fluorescent protein fusions for localization studies

    • Split reporter systems for functional assays

  • Expression optimization:

    • Codon optimization for E. coli expression

    • Signal sequence evaluation for membrane targeting

    • Induction condition optimization (temperature, IPTG concentration)

    • Specialized host strain selection

The optimized protein should maintain the reconstitution conditions shown effective for other CrcB homologs: Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the most effective approaches for studying crcB1 interactions with other membrane proteins?

Studying crcB1 interactions with other membrane proteins requires specialized techniques for membrane protein complexes:

  • In vitro interaction studies:

    • Pull-down assays with differently tagged proteins

    • Surface plasmon resonance with reconstituted proteoliposomes

    • Microscale thermophoresis for binding affinity determination

    • Native mass spectrometry of intact complexes

  • In vivo interaction detection:

    • Split-ubiquitin membrane yeast two-hybrid systems

    • FRET/BRET assays with fluorescent protein fusions

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation from cross-linked membranes

  • Structural approaches for complexes:

    • Cryo-EM of co-purified complexes

    • Cross-linking mass spectrometry to identify interaction surfaces

    • Integrative modeling combining multiple data types

    • Co-crystallization with stabilizing antibody fragments

  • Functional validation:

    • Co-expression studies and phenotypic analysis

    • Ion transport assays with reconstituted complexes

    • Electrophysiology of co-expressed channels

    • Mutagenesis of predicted interaction interfaces

These approaches can reveal whether crcB1 acts alone or as part of larger membrane complexes involved in ion homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.