Listeria innocua is a Gram-positive bacterium that shares significant genetic similarity with the pathogenic Listeria monocytogenes but is generally considered non-pathogenic. While L. monocytogenes is notorious for causing listeriosis, L. innocua has traditionally been viewed as an environmentally ubiquitous but harmless species that serves as an excellent model organism for studying Listeria biology . Despite its classification as non-pathogenic, rare cases of L. innocua infections have been reported in both humans and animals, challenging this conventional understanding .
The CrcB family of proteins represents an evolutionarily conserved group of membrane proteins found across various bacterial species. These proteins are characterized by their putative role in fluoride ion transport, functioning as fluoride ion channels or transporters that protect bacteria from fluoride toxicity. The study of CrcB homolog 2 in L. innocua provides valuable insights into bacterial membrane transport systems and potential resistance mechanisms against environmental stressors.
Understanding recombinant forms of this protein is essential for structural studies, functional characterization, and exploration of potential biotechnological applications. By studying the non-pathogenic L. innocua variant, researchers can gain insights into Listeria biology without the biosafety concerns associated with handling pathogenic strains.
While specific sequence data for L. innocua serovar 6a CrcB2 is not directly provided in the available research, valuable insights can be drawn from the closely related L. monocytogenes serovar 1/2a CrcB2 protein. The L. monocytogenes variant consists of 129 amino acids with the sequence:
"MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMRFLAEKSRVSLVLLNGIGTGFIGAFTTFSAFSVDTIQLVQSGAWLFAVSYVLASFIGGLIMVKFGRMLSNKLLNRGEHRVG"
Based on standard molecular weight calculation methods for proteins, a protein of similar length and composition would have an approximate molecular weight of 14 kDa. This estimation involves summing the weights of individual amino acids while accounting for water loss during peptide bond formation, as demonstrated in computational approaches to protein analysis.
For comparative purposes, the Bacillus cereus CrcB2 protein consists of 118 amino acids with the sequence:
"MIEALLVATGGFFGAITRFAISNWFKKRNKTSFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTTFSTFKLESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMQLGGI"
This comparison reveals both similarities and differences between CrcB homologs across bacterial species. The structural characteristics of these proteins suggest multiple transmembrane domains, consistent with their presumed function in membrane transport. The hydrophobic amino acid content is particularly high, which is typical of membrane-spanning proteins that must interact with the lipid bilayer.
The CrcB homolog 2 protein in L. innocua serovar 6a is classified as a putative fluoride ion transporter based on homology with characterized CrcB proteins in other bacterial species . This classification as "Putative fluoride ion transporter CrcB 2" appears consistently across different bacterial species, indicating evolutionary conservation of function .
Fluoride ion transporters play a crucial role in bacterial homeostasis by protecting cells from fluoride toxicity. Fluoride ions can inhibit various enzymes, particularly those involved in glycolysis and phosphate metabolism, thus posing a significant threat to bacterial survival in fluoride-rich environments. The CrcB2 protein likely facilitates the selective transport of fluoride ions across the cell membrane, maintaining internal fluoride ion concentration below toxic levels.
While CrcB2 proteins primarily function in fluoride transport, they may also interact with other bacterial physiological systems. The genomic context of these proteins could provide additional clues about their functional associations. In some Listeria species, genes associated with membrane transport and stress response are often found in proximity to crcB genes, suggesting potential functional relationships.
The following table compares key characteristics of CrcB2 proteins across different bacterial species:
| Characteristic | L. monocytogenes CrcB2 | B. cereus CrcB2 | L. innocua CrcB2 (predicted) |
|---|---|---|---|
| Amino acid length | 129 | 118 | ~129 (predicted) |
| UniProt ID | Q8Y5I0 | Q631P3 | Not specified |
| Synonyms | crcB2; lmo2082 | crcB2; BCE33L4803 | crcB2 |
| Function | Putative fluoride ion transporter | Putative fluoride ion transporter | Putative fluoride ion transporter |
| Cellular localization | Membrane | Membrane | Membrane (predicted) |
Recombinant production of bacterial proteins like CrcB2 typically involves expression in suitable host systems, most commonly Escherichia coli. Based on protocols used for homologous proteins, the production of recombinant L. innocua serovar 6a CrcB2 would likely follow similar methods to those employed for L. monocytogenes CrcB2.
The general production process includes cloning the crcB2 gene into an expression vector with an appropriate tag (commonly His-tag), transformation into a bacterial expression host, induction of protein expression under optimized conditions, and subsequent cell lysis and extraction of the recombinant protein .
Purification of the recombinant protein typically employs affinity chromatography (utilizing the His-tag), potentially followed by additional purification steps such as size exclusion chromatography or ion exchange chromatography. Quality control assessment using SDS-PAGE typically confirms a purity greater than 90% for research-grade preparations .
The study of L. innocua proteins like CrcB2 provides important insights into the evolution of the Listeria genus. L. innocua serves as a non-pathogenic model for understanding the biology of Listeria species, including the pathogenic L. monocytogenes . Interestingly, while L. innocua is generally considered non-pathogenic, studies have documented rare cases of nervous listeriosis in ruminants associated with non-hemolytic L. innocua isolates .
The recombinant protein may find applications in various biotechnological contexts, including:
Development of biosensors for fluoride detection
Creation of specific antibodies for detection and localization studies
Potential use in bioremediation applications involving fluoride-contaminated environments
Comparative studies to understand bacterial adaptation to environmental stressors
Understanding the role of CrcB2 in fluoride resistance may also have implications for bacterial survival in various environments, including food processing facilities where fluoride-containing compounds might be used as antimicrobial agents.
KEGG: lin:lin2188
STRING: 272626.lin2188
Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 (crcB2) is a recombinantly produced protein expressed from the crcB2 gene of Listeria innocua serovar 6a (strain CLIP 11262). The protein is classified as a CrcB homolog, with its full sequence spanning 129 amino acids (1-129 region). It functions as a putative fluoride ion transporter in the bacterial membrane, playing a crucial role in maintaining ion homeostasis in Listeria cells. The protein is also known under the UniProt identifier Q929T6 and corresponds to the ordered locus name lin2188 within the Listeria innocua genome . Understanding this protein's structure and function contributes to our knowledge of bacterial physiological adaptation mechanisms and potential virulence factors in the Listeria genus.
For optimal research outcomes, Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 requires specific storage and handling protocols:
| Parameter | Recommended Condition | Notes |
|---|---|---|
| Long-term storage | -20°C to -80°C | For extended storage periods |
| Buffer composition | Tris-based buffer with 50% glycerol | Optimized for this specific protein |
| Working aliquots | 4°C | Maintain for up to one week |
| Freeze-thaw cycles | Minimize | Repeated freezing and thawing not recommended |
| Reconstitution | Protein-specific buffer | Follow manufacturer protocols |
The protein is typically supplied as a lyophilized powder or in a storage buffer containing 50% glycerol optimized for stability . For experiments requiring repeated use, creating multiple small working aliquots is recommended to prevent protein degradation from repeated freeze-thaw cycles. This approach preserves structural integrity and biological activity for more consistent experimental results.
Differentiating between CrcB homolog 2 proteins from different Listeria species requires a multi-technique approach:
PCR-REA (Restriction Enzyme Analysis): PCR amplification of the crcB2 gene region followed by restriction enzyme digestion can reveal species-specific polymorphisms. This approach has been successfully applied to differentiate Listeria monocytogenes strains, as demonstrated by studies showing distinct cleavage patterns when using restriction enzymes like AluI .
Epitope Mapping: Develop antibodies that recognize species-specific epitopes in the variable regions (particularly positions 66-75 and the C-terminal domain) where sequence differences are most pronounced.
Protein Mass Fingerprinting: Tryptic digestion followed by mass spectrometry can generate unique peptide patterns for each species variant based on the sequence differences.
Fluoride Transport Assays: Functional assays measuring fluoride ion transport may reveal kinetic differences between the homologs due to the amino acid variations.
The differential methods are particularly important when working with environmental or food samples where both pathogenic and non-pathogenic Listeria species might coexist. Research indicates that traditional enrichment procedures may introduce bias favoring certain strains, as shown in studies where L. innocua outcompeted L. monocytogenes lineage 1 strains in selective media .
Investigating the membrane topology and transport function of CrcB homolog 2 requires specialized techniques:
Membrane Topology Analysis:
Cysteine Scanning Mutagenesis: Systematically replace amino acids with cysteines and use membrane-impermeable thiol-reactive reagents to map exposed residues.
GFP-Fusion Analysis: Create fusion constructs with GFP at different positions to determine cytoplasmic versus periplasmic localization.
Protease Accessibility Assays: Determine which protein regions are accessible to proteases in intact versus disrupted membrane preparations.
Transport Function Characterization:
Fluoride-Selective Electrode Measurements: Monitor fluoride ion movement across membranes in reconstituted proteoliposomes.
Fluorescent Probes: Use pH-sensitive or ion-sensitive fluorescent dyes to track transport activity in real-time.
Isotope Flux Assays: Employ radioactive fluoride (18F) to quantitatively assess transport rates and kinetics.
Structural Studies:
Cryo-EM: For higher-resolution structural determination of the membrane-embedded protein.
Molecular Dynamics Simulations: To predict ion permeation pathways based on the available sequence data.
These methodological approaches should be adapted based on specific research questions and available resources, as transport proteins like CrcB homolog 2 present unique experimental challenges due to their hydrophobic nature and membrane localization.
PCR-REA (Restriction Enzyme Analysis) optimization for crcB2 genetic variation studies should follow these methodological guidelines:
Primer Design Strategy:
Design primers targeting conserved regions flanking the crcB2 gene
Include at least 50-100 bp upstream and downstream of the coding region
Optimal primer positioning should account for known polymorphic sites
PCR Amplification Parameters:
Initial denaturation: 95°C for 5 minutes
30-35 cycles of: denaturation (95°C, 30s), annealing (58-62°C, 30s), extension (72°C, 1 min per kb)
Final extension: 72°C for 7 minutes
Use high-fidelity polymerase to minimize amplification errors
Restriction Enzyme Selection:
Gel Electrophoresis Optimization:
Use 2-3% agarose gels for better resolution of smaller fragments
Include marker ladders appropriate for expected fragment sizes
Consider capillary electrophoresis for more precise fragment sizing
Analysis and Interpretation:
Document banding patterns digitally
Create a database of restriction profiles for different species and strains
Perform cluster analysis to establish phylogenetic relationships
This approach has been successfully applied to differentiate Listeria monocytogenes strains, where PCR-REA revealed two distinct profiles among 100 strains of serovar 1/2a, demonstrating the utility of this method for strain typing . The same principles can be applied to study crcB2 genetic variations across different Listeria species.
The fluoride transport function of CrcB homolog 2 represents a critical bacterial defense mechanism against environmental fluoride toxicity. Fluoride ions can inhibit essential enzymes like enolase and pyrophosphatase, disrupting bacterial metabolism. The significance and experimental approach to studying this function includes:
Physiological Significance:
Environmental adaptation to fluoride-rich niches
Potential contribution to survival in host environments
Possible role in virulence regulation through metabolic adaptations
Recommended Experimental Designs:
Growth Inhibition Assays:
Compare wild-type vs. crcB2 knockout strains in media with varying fluoride concentrations
Measure growth curves using spectrophotometry at OD600
Determine minimum inhibitory concentrations (MIC) for fluoride
| Strain Type | MIC Range (Expected) | Growth Rate in Sub-MIC Fluoride |
|---|---|---|
| Wild-type | 50-200 mM NaF | Moderate inhibition |
| ΔcrcB2 | 5-20 mM NaF | Severe inhibition |
| crcB2 overexpression | 200-400 mM NaF | Minimal inhibition |
Fluoride Uptake/Efflux Measurements:
Load bacterial cells with fluoride
Monitor efflux using ion-selective electrodes
Compare transport kinetics between L. innocua and L. monocytogenes CrcB2 proteins
Protein-Protein Interaction Studies:
Identify potential interaction partners using pull-down assays
Verify interactions with techniques like Förster Resonance Energy Transfer (FRET)
Map interaction domains through truncation experiments
In vivo Localization:
Create fluorescent protein fusions
Use super-resolution microscopy to determine subcellular localization
Monitor dynamic changes in response to fluoride challenge
Comparative Genomics Approach:
Analyze crcB2 conservation across Listeria species
Correlate sequence variations with habitat preferences and fluoride resistance
These experimental designs would provide comprehensive insights into the biological role of CrcB homolog 2 in Listeria species and potentially reveal differences in fluoride handling between pathogenic and non-pathogenic strains.
Optimizing expression and purification of Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 requires careful consideration of the protein's membrane-associated nature:
Expression Systems Comparison:
| Expression System | Advantages | Disadvantages | Yield Expectation |
|---|---|---|---|
| E. coli BL21(DE3) | High yield, cost-effective, rapid growth | Possible inclusion body formation, potential toxicity | 5-10 mg/L culture |
| E. coli C41/C43 | Specialized for membrane proteins, reduced toxicity | Lower yields than standard strains | 2-5 mg/L culture |
| Yeast (P. pastoris) | Better membrane protein folding, post-translational modifications | Longer production time, more complex protocols | 1-3 mg/L culture |
| Cell-free systems | Avoids toxicity issues, rapid production | Higher cost, lower yield | 0.5-1 mg/mg microsomal membrane |
Recommended Purification Strategy:
Expression Optimization:
Induce at lower temperatures (16-25°C)
Use mild inducers (0.1-0.5 mM IPTG for E. coli)
Supplement media with glycerol to stabilize membrane proteins
Cell Lysis and Membrane Preparation:
Gentle lysis using French press or sonication
Differential centrifugation to isolate membrane fractions
Solubilization screening with detergents (DDM, LMNG, or FC-12)
Affinity Purification:
IMAC purification using N-terminal His-tag
Optimize imidazole concentrations to minimize non-specific binding
Consider on-column detergent exchange
Polishing Steps:
Size exclusion chromatography to isolate monodisperse protein
Ion exchange chromatography if required for higher purity
Concentration using specialized membrane filters suitable for detergent-solubilized proteins
Quality Control Assessments:
SDS-PAGE and Western blotting for purity verification
Dynamic light scattering for monodispersity
Circular dichroism for secondary structure confirmation
Fluoride binding assays for functional validation
Current protocols have successfully produced this protein with >90% purity using E. coli expression systems with N-terminal His-tags, demonstrating the feasibility of this approach .
Comprehensive bioinformatic analysis of CrcB homolog proteins should employ multiple complementary approaches:
Structure-Function Prediction:
Transmembrane Topology Prediction:
TMHMM, HMMTOP, and TOPCONS for consensus membrane topology
Expected result: 3-4 transmembrane helices common in fluoride channel proteins
Functional Domain Identification:
InterProScan and Pfam database searches
Conserved Domain Database (CDD) analysis
Focus on potential fluoride-binding motifs and channel-forming regions
3D Structure Prediction:
AlphaFold2 or RoseTTAFold for ab initio structure prediction
Homology modeling based on related crystal structures
Molecular dynamics simulations to identify potential ion permeation pathways
Evolutionary Analysis:
Phylogenetic Tree Construction:
Multiple sequence alignment using MUSCLE or MAFFT
Maximum Likelihood tree using RAxML or IQ-TREE
Bayesian inference methods for robust tree topology
Selection Pressure Analysis:
Calculate dN/dS ratios to identify positively selected sites
PAML or HyPhy for codon-based selection analysis
Focus on species-specific variations that might relate to pathogenicity
Horizontal Gene Transfer Assessment:
Analyze GC content and codon usage patterns
Identify potential recombination events using programs like RDP4
Investigate genomic context conservation across species
Comparative Genomics:
Synteny Analysis:
Compare gene neighborhoods across Listeria species
Identify conserved operonic structures potentially related to function
Map genomic rearrangements near crcB homologs
Pan-genome Analysis:
Determine if crcB homologs belong to core or accessory genome
Correlate presence/absence patterns with ecological niches
These bioinformatic approaches provide a foundation for hypothesis generation about CrcB function and evolution, guiding subsequent experimental designs and interpretations.
Addressing enrichment bias is critical for accurate ecological and functional studies of Listeria species:
Methodological Solutions to Enrichment Bias:
Direct Detection Methods:
Develop species-specific PCR assays targeting crcB2 variants
Use next-generation sequencing for culture-independent analysis
Apply fluorescence in situ hybridization (FISH) with species-specific probes
Modified Enrichment Protocols:
Adjust selective agent concentrations based on comparative growth studies
Implement shorter enrichment periods to minimize competitive exclusion
Use multiple parallel enrichment media formulations
Quantitative Monitoring During Enrichment:
Employ digital PCR to track population dynamics during enrichment
Use strain-specific markers to monitor relative abundance changes
Implement flow cytometry with fluorescent antibody labeling
Competition-Based Experimental Design:
Conduct mixed-culture experiments with defined starting ratios
Track species/strain proportions over time under various conditions
Create growth curves in both selective and non-selective media
Research has demonstrated that Listeria innocua can outcompete Listeria monocytogenes lineage 1 strains but not lineage 2 strains in selective media like University of Vermont medium (UVM) . This competitive advantage does not manifest in non-selective brain heart infusion (BHI) medium, indicating that selective agents directly influence species recovery bias .
Recommended Experimental Controls:
| Experimental Approach | Control Method | Expected Outcome |
|---|---|---|
| Pure culture growth curves | Compare growth rates in selective vs. non-selective media | Quantify selective agent effects on each species |
| Mixed culture competition | Artificially mix known quantities before enrichment | Determine recovery bias factors for correction |
| Spiked sample studies | Add known quantities to real samples | Validate recovery rates in complex matrices |
| Modified enrichment protocols | Systematically vary selective agent concentrations | Establish optimal conditions for balanced recovery |
By implementing these methodological controls and alternative approaches, researchers can minimize enrichment bias and obtain more accurate representations of Listeria species diversity in environmental and food samples.
Studying CrcB homolog 2 in Listeria species provides significant insights into bacterial fluoride resistance mechanisms with broader implications:
Fundamental Understanding:
The CrcB protein family represents an evolutionarily conserved mechanism for fluoride resistance across bacterial kingdoms. Research on Listeria CrcB homologs contributes to understanding how different bacteria adapt to fluoride toxicity through similar molecular mechanisms but with species-specific variations.
Structural and functional studies of CrcB homolog 2 can reveal how membrane proteins evolve specialized ion selectivity, providing fundamental knowledge about ion channel biophysics and molecular evolution.
Experimental Approaches:
Comparative Resistance Studies:
Challenge different Listeria species with fluoride under various conditions
Correlate resistance levels with CrcB sequence variations
Measure intracellular versus extracellular fluoride concentrations
Heterologous Expression Experiments:
Express Listeria CrcB homologs in fluoride-sensitive bacterial strains
Quantify conferred resistance
Create chimeric proteins to map functional domains
Mutagenesis Studies:
Target conserved versus variable residues
Assess impact on fluoride transport and resistance
Identify critical residues for channel function
Ecological Relevance Investigations:
Sample environments with varying fluoride concentrations
Correlate CrcB variants with habitat fluoride levels
Examine co-evolution of fluoride resistance mechanisms
Practical Applications:
Developing novel antimicrobial strategies targeting fluoride homeostasis
Bioengineering bacteria with enhanced fluoride resistance for industrial applications
Creating biosensors for environmental fluoride detection
By understanding how CrcB homolog 2 contributes to fluoride resistance in Listeria innocua versus pathogenic Listeria species, researchers can gain insights into the evolutionary adaptations that enable bacterial survival in diverse environments.
Designing robust comparative studies between pathogenic and non-pathogenic Listeria species using CrcB homolog proteins requires careful experimental planning:
Experimental Design Framework:
Strain Selection Strategy:
Include multiple strains from each species (L. innocua, L. monocytogenes)
Select L. monocytogenes strains from different lineages (1 and 2)
Include environmental and clinical isolates for ecological breadth
Consider reference strains with complete genome sequences
Multi-level Comparative Analysis:
Genomic Level:
Sequence crcB2 genes from all selected strains
Analyze promoter regions and regulatory elements
Examine genomic context and potential operonic structures
Transcriptomic Level:
Compare crcB2 expression under standard conditions
Assess response to fluoride challenge
Identify co-regulated genes through RNA-Seq
Proteomic Level:
Quantify CrcB2 protein abundance in membrane fractions
Compare post-translational modifications
Identify interaction partners through pull-down experiments
Phenotypic Level:
Measure fluoride resistance profiles
Assess growth in various environmental conditions
Determine impact on virulence-associated phenotypes
Methodological Controls:
Ensure identical growth and testing conditions
Include wild-type and knockout controls
Perform complementation tests to confirm phenotypic differences
Integration with Virulence Studies:
Test whether fluoride resistance correlates with virulence potential
Examine CrcB2 expression during infection models
Investigate potential links to stress response networks
Previous studies have demonstrated differences in competitive growth between Listeria species in selective media, with lineage 2 L. monocytogenes strains showing different competitive abilities compared to lineage 1 strains when grown with L. innocua . These findings suggest that membrane protein variations may contribute to both ecological fitness and potentially pathogenic potential.
Investigating the three-dimensional structure of membrane proteins like CrcB homolog 2 presents unique challenges requiring specialized approaches:
Recommended Structural Biology Techniques:
Experimental Design Considerations:
| Technique | Sample Requirements | Resolution Range | Special Considerations |
|---|---|---|---|
| X-ray Crystallography | 5-10 mg purified protein | 1.5-3.5 Å | Screen multiple crystallization conditions |
| Cryo-EM | 3-5 mg purified protein | 2.5-4 Å | Consider protein size limitations |
| Solution NMR | 15N/13C labeled protein, 5-10 mg | 3-5 Å | Limited to proteins <25-30 kDa |
| Solid-state NMR | 2D crystals or reconstituted samples | 3-5 Å | No size limitation but complex interpretation |
| Integrative approaches | Varies by technique | N/A | Combines multiple data sources |
For optimal results, a multi-technique approach is recommended, where low-resolution models from computational prediction or SAXS guide experimental design for higher-resolution techniques like cryo-EM or X-ray crystallography. The structural insights gained would significantly advance understanding of fluoride transport mechanisms in bacteria.
Emerging research on Listeria CrcB homolog proteins presents several promising directions that integrate molecular microbiology, structural biology, and pathogenesis:
Systems Biology Integration:
Mapping CrcB2 within the broader regulatory networks responding to environmental stress
Investigating potential moonlighting functions beyond fluoride transport
Developing predictive models of bacterial adaptation based on CrcB functionality
Host-Pathogen Interaction Studies:
Exploring whether CrcB homologs contribute to survival within host phagocytes
Investigating potential roles in biofilm formation and persistence
Determining if fluoride transport affects virulence gene expression
Drug Discovery Applications:
Targeting CrcB homologs as novel antimicrobial targets
Developing selective inhibitors of bacterial fluoride channels
Exploring combination therapies that disrupt ion homeostasis
Ecological and Evolutionary Studies:
Investigating the distribution and diversity of CrcB variants across environmental niches
Examining horizontal gene transfer patterns of fluoride resistance determinants
Exploring co-evolution with other ion transport systems
Synthetic Biology Applications:
Engineering fluoride-responsive biosensors using CrcB components
Developing bacterial chassis with enhanced fluoride resistance for bioremediation
Creating tunable gene expression systems controlled by fluoride levels
The differentiation of CrcB homologs between pathogenic and non-pathogenic Listeria species, such as L. monocytogenes and L. innocua, provides a valuable model system for investigating how membrane transport proteins contribute to bacterial adaptation and potentially to virulence mechanisms . The study of these proteins intersects with broader questions of bacterial stress responses, environmental adaptation, and host-pathogen interactions.