Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Introduction

Listeria innocua is a Gram-positive bacterium that shares significant genetic similarity with the pathogenic Listeria monocytogenes but is generally considered non-pathogenic. While L. monocytogenes is notorious for causing listeriosis, L. innocua has traditionally been viewed as an environmentally ubiquitous but harmless species that serves as an excellent model organism for studying Listeria biology . Despite its classification as non-pathogenic, rare cases of L. innocua infections have been reported in both humans and animals, challenging this conventional understanding .

The CrcB family of proteins represents an evolutionarily conserved group of membrane proteins found across various bacterial species. These proteins are characterized by their putative role in fluoride ion transport, functioning as fluoride ion channels or transporters that protect bacteria from fluoride toxicity. The study of CrcB homolog 2 in L. innocua provides valuable insights into bacterial membrane transport systems and potential resistance mechanisms against environmental stressors.

Understanding recombinant forms of this protein is essential for structural studies, functional characterization, and exploration of potential biotechnological applications. By studying the non-pathogenic L. innocua variant, researchers can gain insights into Listeria biology without the biosafety concerns associated with handling pathogenic strains.

Amino Acid Sequence and Molecular Properties

While specific sequence data for L. innocua serovar 6a CrcB2 is not directly provided in the available research, valuable insights can be drawn from the closely related L. monocytogenes serovar 1/2a CrcB2 protein. The L. monocytogenes variant consists of 129 amino acids with the sequence:

"MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMRFLAEKSRVSLVLLNGIGTGFIGAFTTFSAFSVDTIQLVQSGAWLFAVSYVLASFIGGLIMVKFGRMLSNKLLNRGEHRVG"

Based on standard molecular weight calculation methods for proteins, a protein of similar length and composition would have an approximate molecular weight of 14 kDa. This estimation involves summing the weights of individual amino acids while accounting for water loss during peptide bond formation, as demonstrated in computational approaches to protein analysis.

Comparative Analysis with Homologous Proteins

For comparative purposes, the Bacillus cereus CrcB2 protein consists of 118 amino acids with the sequence:

"MIEALLVATGGFFGAITRFAISNWFKKRNKTSFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTTFSTFKLESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMQLGGI"

This comparison reveals both similarities and differences between CrcB homologs across bacterial species. The structural characteristics of these proteins suggest multiple transmembrane domains, consistent with their presumed function in membrane transport. The hydrophobic amino acid content is particularly high, which is typical of membrane-spanning proteins that must interact with the lipid bilayer.

Primary Function as Fluoride Ion Transporter

The CrcB homolog 2 protein in L. innocua serovar 6a is classified as a putative fluoride ion transporter based on homology with characterized CrcB proteins in other bacterial species . This classification as "Putative fluoride ion transporter CrcB 2" appears consistently across different bacterial species, indicating evolutionary conservation of function .

Fluoride ion transporters play a crucial role in bacterial homeostasis by protecting cells from fluoride toxicity. Fluoride ions can inhibit various enzymes, particularly those involved in glycolysis and phosphate metabolism, thus posing a significant threat to bacterial survival in fluoride-rich environments. The CrcB2 protein likely facilitates the selective transport of fluoride ions across the cell membrane, maintaining internal fluoride ion concentration below toxic levels.

Position within Bacterial Physiological Systems

While CrcB2 proteins primarily function in fluoride transport, they may also interact with other bacterial physiological systems. The genomic context of these proteins could provide additional clues about their functional associations. In some Listeria species, genes associated with membrane transport and stress response are often found in proximity to crcB genes, suggesting potential functional relationships.

The following table compares key characteristics of CrcB2 proteins across different bacterial species:

CharacteristicL. monocytogenes CrcB2B. cereus CrcB2L. innocua CrcB2 (predicted)
Amino acid length129118~129 (predicted)
UniProt IDQ8Y5I0Q631P3Not specified
SynonymscrcB2; lmo2082crcB2; BCE33L4803crcB2
FunctionPutative fluoride ion transporterPutative fluoride ion transporterPutative fluoride ion transporter
Cellular localizationMembraneMembraneMembrane (predicted)

Expression Systems and Production Protocols

Recombinant production of bacterial proteins like CrcB2 typically involves expression in suitable host systems, most commonly Escherichia coli. Based on protocols used for homologous proteins, the production of recombinant L. innocua serovar 6a CrcB2 would likely follow similar methods to those employed for L. monocytogenes CrcB2.

The general production process includes cloning the crcB2 gene into an expression vector with an appropriate tag (commonly His-tag), transformation into a bacterial expression host, induction of protein expression under optimized conditions, and subsequent cell lysis and extraction of the recombinant protein .

Purification and Quality Control

Purification of the recombinant protein typically employs affinity chromatography (utilizing the His-tag), potentially followed by additional purification steps such as size exclusion chromatography or ion exchange chromatography. Quality control assessment using SDS-PAGE typically confirms a purity greater than 90% for research-grade preparations .

Comparative Genomics and Evolution

The study of L. innocua proteins like CrcB2 provides important insights into the evolution of the Listeria genus. L. innocua serves as a non-pathogenic model for understanding the biology of Listeria species, including the pathogenic L. monocytogenes . Interestingly, while L. innocua is generally considered non-pathogenic, studies have documented rare cases of nervous listeriosis in ruminants associated with non-hemolytic L. innocua isolates .

Biotechnological Applications

The recombinant protein may find applications in various biotechnological contexts, including:

  • Development of biosensors for fluoride detection

  • Creation of specific antibodies for detection and localization studies

  • Potential use in bioremediation applications involving fluoride-contaminated environments

  • Comparative studies to understand bacterial adaptation to environmental stressors

Understanding the role of CrcB2 in fluoride resistance may also have implications for bacterial survival in various environments, including food processing facilities where fluoride-containing compounds might be used as antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; lin2188; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
crcB2
Target Protein Sequence
MYFLYVGIFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFIMPFLAEKSRISLV LLNGIGTGFIGAFTTFSAFSVDTIELLQQGEVVLAISYILVSLIGGLVMVKFGRRFSNKL LRRGAHHVD
Uniprot No.

Target Background

Function
CrcB2 is crucial for reducing fluoride concentration within cells, thus mitigating its toxicity.
Database Links

KEGG: lin:lin2188

STRING: 272626.lin2188

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 (crcB2) and its biological significance?

Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 (crcB2) is a recombinantly produced protein expressed from the crcB2 gene of Listeria innocua serovar 6a (strain CLIP 11262). The protein is classified as a CrcB homolog, with its full sequence spanning 129 amino acids (1-129 region). It functions as a putative fluoride ion transporter in the bacterial membrane, playing a crucial role in maintaining ion homeostasis in Listeria cells. The protein is also known under the UniProt identifier Q929T6 and corresponds to the ordered locus name lin2188 within the Listeria innocua genome . Understanding this protein's structure and function contributes to our knowledge of bacterial physiological adaptation mechanisms and potential virulence factors in the Listeria genus.

What are the optimal storage and handling conditions for Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2?

For optimal research outcomes, Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 requires specific storage and handling protocols:

ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CFor extended storage periods
Buffer compositionTris-based buffer with 50% glycerolOptimized for this specific protein
Working aliquots4°CMaintain for up to one week
Freeze-thaw cyclesMinimizeRepeated freezing and thawing not recommended
ReconstitutionProtein-specific bufferFollow manufacturer protocols

The protein is typically supplied as a lyophilized powder or in a storage buffer containing 50% glycerol optimized for stability . For experiments requiring repeated use, creating multiple small working aliquots is recommended to prevent protein degradation from repeated freeze-thaw cycles. This approach preserves structural integrity and biological activity for more consistent experimental results.

How can researchers differentiate between Listeria innocua CrcB homolog 2 and similar proteins from pathogenic Listeria species in experimental systems?

Differentiating between CrcB homolog 2 proteins from different Listeria species requires a multi-technique approach:

  • PCR-REA (Restriction Enzyme Analysis): PCR amplification of the crcB2 gene region followed by restriction enzyme digestion can reveal species-specific polymorphisms. This approach has been successfully applied to differentiate Listeria monocytogenes strains, as demonstrated by studies showing distinct cleavage patterns when using restriction enzymes like AluI .

  • Epitope Mapping: Develop antibodies that recognize species-specific epitopes in the variable regions (particularly positions 66-75 and the C-terminal domain) where sequence differences are most pronounced.

  • Protein Mass Fingerprinting: Tryptic digestion followed by mass spectrometry can generate unique peptide patterns for each species variant based on the sequence differences.

  • Fluoride Transport Assays: Functional assays measuring fluoride ion transport may reveal kinetic differences between the homologs due to the amino acid variations.

The differential methods are particularly important when working with environmental or food samples where both pathogenic and non-pathogenic Listeria species might coexist. Research indicates that traditional enrichment procedures may introduce bias favoring certain strains, as shown in studies where L. innocua outcompeted L. monocytogenes lineage 1 strains in selective media .

What methodological approaches are recommended for studying the membrane topology and transport function of CrcB homolog 2 proteins?

Investigating the membrane topology and transport function of CrcB homolog 2 requires specialized techniques:

Membrane Topology Analysis:

  • Cysteine Scanning Mutagenesis: Systematically replace amino acids with cysteines and use membrane-impermeable thiol-reactive reagents to map exposed residues.

  • GFP-Fusion Analysis: Create fusion constructs with GFP at different positions to determine cytoplasmic versus periplasmic localization.

  • Protease Accessibility Assays: Determine which protein regions are accessible to proteases in intact versus disrupted membrane preparations.

Transport Function Characterization:

  • Fluoride-Selective Electrode Measurements: Monitor fluoride ion movement across membranes in reconstituted proteoliposomes.

  • Fluorescent Probes: Use pH-sensitive or ion-sensitive fluorescent dyes to track transport activity in real-time.

  • Isotope Flux Assays: Employ radioactive fluoride (18F) to quantitatively assess transport rates and kinetics.

Structural Studies:

  • Cryo-EM: For higher-resolution structural determination of the membrane-embedded protein.

  • Molecular Dynamics Simulations: To predict ion permeation pathways based on the available sequence data.

These methodological approaches should be adapted based on specific research questions and available resources, as transport proteins like CrcB homolog 2 present unique experimental challenges due to their hydrophobic nature and membrane localization.

How can PCR-REA techniques be optimized for studying genetic variations in crcB2 across different Listeria species and strains?

PCR-REA (Restriction Enzyme Analysis) optimization for crcB2 genetic variation studies should follow these methodological guidelines:

  • Primer Design Strategy:

    • Design primers targeting conserved regions flanking the crcB2 gene

    • Include at least 50-100 bp upstream and downstream of the coding region

    • Optimal primer positioning should account for known polymorphic sites

  • PCR Amplification Parameters:

    • Initial denaturation: 95°C for 5 minutes

    • 30-35 cycles of: denaturation (95°C, 30s), annealing (58-62°C, 30s), extension (72°C, 1 min per kb)

    • Final extension: 72°C for 7 minutes

    • Use high-fidelity polymerase to minimize amplification errors

  • Restriction Enzyme Selection:

    • Based on sequence analysis of known crcB2 variants, select enzymes with differential cut sites

    • AluI has proven effective for Listeria differentiation in previous studies

    • Consider enzymes targeting the variable regions identified in sequence comparisons

  • Gel Electrophoresis Optimization:

    • Use 2-3% agarose gels for better resolution of smaller fragments

    • Include marker ladders appropriate for expected fragment sizes

    • Consider capillary electrophoresis for more precise fragment sizing

  • Analysis and Interpretation:

    • Document banding patterns digitally

    • Create a database of restriction profiles for different species and strains

    • Perform cluster analysis to establish phylogenetic relationships

This approach has been successfully applied to differentiate Listeria monocytogenes strains, where PCR-REA revealed two distinct profiles among 100 strains of serovar 1/2a, demonstrating the utility of this method for strain typing . The same principles can be applied to study crcB2 genetic variations across different Listeria species.

What is the significance of fluoride transport function in Listeria species and what experimental designs are recommended to investigate this function?

The fluoride transport function of CrcB homolog 2 represents a critical bacterial defense mechanism against environmental fluoride toxicity. Fluoride ions can inhibit essential enzymes like enolase and pyrophosphatase, disrupting bacterial metabolism. The significance and experimental approach to studying this function includes:

Physiological Significance:

  • Environmental adaptation to fluoride-rich niches

  • Potential contribution to survival in host environments

  • Possible role in virulence regulation through metabolic adaptations

Recommended Experimental Designs:

  • Growth Inhibition Assays:

    • Compare wild-type vs. crcB2 knockout strains in media with varying fluoride concentrations

    • Measure growth curves using spectrophotometry at OD600

    • Determine minimum inhibitory concentrations (MIC) for fluoride

    Strain TypeMIC Range (Expected)Growth Rate in Sub-MIC Fluoride
    Wild-type50-200 mM NaFModerate inhibition
    ΔcrcB25-20 mM NaFSevere inhibition
    crcB2 overexpression200-400 mM NaFMinimal inhibition
  • Fluoride Uptake/Efflux Measurements:

    • Load bacterial cells with fluoride

    • Monitor efflux using ion-selective electrodes

    • Compare transport kinetics between L. innocua and L. monocytogenes CrcB2 proteins

  • Protein-Protein Interaction Studies:

    • Identify potential interaction partners using pull-down assays

    • Verify interactions with techniques like Förster Resonance Energy Transfer (FRET)

    • Map interaction domains through truncation experiments

  • In vivo Localization:

    • Create fluorescent protein fusions

    • Use super-resolution microscopy to determine subcellular localization

    • Monitor dynamic changes in response to fluoride challenge

  • Comparative Genomics Approach:

    • Analyze crcB2 conservation across Listeria species

    • Correlate sequence variations with habitat preferences and fluoride resistance

These experimental designs would provide comprehensive insights into the biological role of CrcB homolog 2 in Listeria species and potentially reveal differences in fluoride handling between pathogenic and non-pathogenic strains.

What are the best expression systems and purification strategies for obtaining high-quality Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2?

Optimizing expression and purification of Recombinant Listeria innocua serovar 6a Protein CrcB homolog 2 requires careful consideration of the protein's membrane-associated nature:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesYield Expectation
E. coli BL21(DE3)High yield, cost-effective, rapid growthPossible inclusion body formation, potential toxicity5-10 mg/L culture
E. coli C41/C43Specialized for membrane proteins, reduced toxicityLower yields than standard strains2-5 mg/L culture
Yeast (P. pastoris)Better membrane protein folding, post-translational modificationsLonger production time, more complex protocols1-3 mg/L culture
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, lower yield0.5-1 mg/mg microsomal membrane

Recommended Purification Strategy:

  • Expression Optimization:

    • Induce at lower temperatures (16-25°C)

    • Use mild inducers (0.1-0.5 mM IPTG for E. coli)

    • Supplement media with glycerol to stabilize membrane proteins

  • Cell Lysis and Membrane Preparation:

    • Gentle lysis using French press or sonication

    • Differential centrifugation to isolate membrane fractions

    • Solubilization screening with detergents (DDM, LMNG, or FC-12)

  • Affinity Purification:

    • IMAC purification using N-terminal His-tag

    • Optimize imidazole concentrations to minimize non-specific binding

    • Consider on-column detergent exchange

  • Polishing Steps:

    • Size exclusion chromatography to isolate monodisperse protein

    • Ion exchange chromatography if required for higher purity

    • Concentration using specialized membrane filters suitable for detergent-solubilized proteins

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting for purity verification

    • Dynamic light scattering for monodispersity

    • Circular dichroism for secondary structure confirmation

    • Fluoride binding assays for functional validation

Current protocols have successfully produced this protein with >90% purity using E. coli expression systems with N-terminal His-tags, demonstrating the feasibility of this approach .

What bioinformatic approaches are recommended for predicting functional domains and evolutionary relationships of CrcB homolog proteins?

Comprehensive bioinformatic analysis of CrcB homolog proteins should employ multiple complementary approaches:

Structure-Function Prediction:

  • Transmembrane Topology Prediction:

    • TMHMM, HMMTOP, and TOPCONS for consensus membrane topology

    • Expected result: 3-4 transmembrane helices common in fluoride channel proteins

  • Functional Domain Identification:

    • InterProScan and Pfam database searches

    • Conserved Domain Database (CDD) analysis

    • Focus on potential fluoride-binding motifs and channel-forming regions

  • 3D Structure Prediction:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Homology modeling based on related crystal structures

    • Molecular dynamics simulations to identify potential ion permeation pathways

Evolutionary Analysis:

  • Phylogenetic Tree Construction:

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Maximum Likelihood tree using RAxML or IQ-TREE

    • Bayesian inference methods for robust tree topology

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify positively selected sites

    • PAML or HyPhy for codon-based selection analysis

    • Focus on species-specific variations that might relate to pathogenicity

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content and codon usage patterns

    • Identify potential recombination events using programs like RDP4

    • Investigate genomic context conservation across species

Comparative Genomics:

  • Synteny Analysis:

    • Compare gene neighborhoods across Listeria species

    • Identify conserved operonic structures potentially related to function

    • Map genomic rearrangements near crcB homologs

  • Pan-genome Analysis:

    • Determine if crcB homologs belong to core or accessory genome

    • Correlate presence/absence patterns with ecological niches

These bioinformatic approaches provide a foundation for hypothesis generation about CrcB function and evolution, guiding subsequent experimental designs and interpretations.

How can researchers address the potential bias in enrichment procedures when isolating and studying different Listeria species and their proteins?

Addressing enrichment bias is critical for accurate ecological and functional studies of Listeria species:

Methodological Solutions to Enrichment Bias:

  • Direct Detection Methods:

    • Develop species-specific PCR assays targeting crcB2 variants

    • Use next-generation sequencing for culture-independent analysis

    • Apply fluorescence in situ hybridization (FISH) with species-specific probes

  • Modified Enrichment Protocols:

    • Adjust selective agent concentrations based on comparative growth studies

    • Implement shorter enrichment periods to minimize competitive exclusion

    • Use multiple parallel enrichment media formulations

  • Quantitative Monitoring During Enrichment:

    • Employ digital PCR to track population dynamics during enrichment

    • Use strain-specific markers to monitor relative abundance changes

    • Implement flow cytometry with fluorescent antibody labeling

  • Competition-Based Experimental Design:

    • Conduct mixed-culture experiments with defined starting ratios

    • Track species/strain proportions over time under various conditions

    • Create growth curves in both selective and non-selective media

Research has demonstrated that Listeria innocua can outcompete Listeria monocytogenes lineage 1 strains but not lineage 2 strains in selective media like University of Vermont medium (UVM) . This competitive advantage does not manifest in non-selective brain heart infusion (BHI) medium, indicating that selective agents directly influence species recovery bias .

Recommended Experimental Controls:

Experimental ApproachControl MethodExpected Outcome
Pure culture growth curvesCompare growth rates in selective vs. non-selective mediaQuantify selective agent effects on each species
Mixed culture competitionArtificially mix known quantities before enrichmentDetermine recovery bias factors for correction
Spiked sample studiesAdd known quantities to real samplesValidate recovery rates in complex matrices
Modified enrichment protocolsSystematically vary selective agent concentrationsEstablish optimal conditions for balanced recovery

By implementing these methodological controls and alternative approaches, researchers can minimize enrichment bias and obtain more accurate representations of Listeria species diversity in environmental and food samples.

What are the implications of studying CrcB homolog 2 for understanding bacterial fluoride resistance mechanisms?

Studying CrcB homolog 2 in Listeria species provides significant insights into bacterial fluoride resistance mechanisms with broader implications:

Fundamental Understanding:

  • The CrcB protein family represents an evolutionarily conserved mechanism for fluoride resistance across bacterial kingdoms. Research on Listeria CrcB homologs contributes to understanding how different bacteria adapt to fluoride toxicity through similar molecular mechanisms but with species-specific variations.

  • Structural and functional studies of CrcB homolog 2 can reveal how membrane proteins evolve specialized ion selectivity, providing fundamental knowledge about ion channel biophysics and molecular evolution.

Experimental Approaches:

  • Comparative Resistance Studies:

    • Challenge different Listeria species with fluoride under various conditions

    • Correlate resistance levels with CrcB sequence variations

    • Measure intracellular versus extracellular fluoride concentrations

  • Heterologous Expression Experiments:

    • Express Listeria CrcB homologs in fluoride-sensitive bacterial strains

    • Quantify conferred resistance

    • Create chimeric proteins to map functional domains

  • Mutagenesis Studies:

    • Target conserved versus variable residues

    • Assess impact on fluoride transport and resistance

    • Identify critical residues for channel function

  • Ecological Relevance Investigations:

    • Sample environments with varying fluoride concentrations

    • Correlate CrcB variants with habitat fluoride levels

    • Examine co-evolution of fluoride resistance mechanisms

Practical Applications:

  • Developing novel antimicrobial strategies targeting fluoride homeostasis

  • Bioengineering bacteria with enhanced fluoride resistance for industrial applications

  • Creating biosensors for environmental fluoride detection

By understanding how CrcB homolog 2 contributes to fluoride resistance in Listeria innocua versus pathogenic Listeria species, researchers can gain insights into the evolutionary adaptations that enable bacterial survival in diverse environments.

How can researchers design comparative studies between pathogenic and non-pathogenic Listeria species using CrcB homolog proteins as a model?

Designing robust comparative studies between pathogenic and non-pathogenic Listeria species using CrcB homolog proteins requires careful experimental planning:

Experimental Design Framework:

  • Strain Selection Strategy:

    • Include multiple strains from each species (L. innocua, L. monocytogenes)

    • Select L. monocytogenes strains from different lineages (1 and 2)

    • Include environmental and clinical isolates for ecological breadth

    • Consider reference strains with complete genome sequences

  • Multi-level Comparative Analysis:

    Genomic Level:

    • Sequence crcB2 genes from all selected strains

    • Analyze promoter regions and regulatory elements

    • Examine genomic context and potential operonic structures

    Transcriptomic Level:

    • Compare crcB2 expression under standard conditions

    • Assess response to fluoride challenge

    • Identify co-regulated genes through RNA-Seq

    Proteomic Level:

    • Quantify CrcB2 protein abundance in membrane fractions

    • Compare post-translational modifications

    • Identify interaction partners through pull-down experiments

    Phenotypic Level:

    • Measure fluoride resistance profiles

    • Assess growth in various environmental conditions

    • Determine impact on virulence-associated phenotypes

  • Methodological Controls:

    • Ensure identical growth and testing conditions

    • Include wild-type and knockout controls

    • Perform complementation tests to confirm phenotypic differences

  • Integration with Virulence Studies:

    • Test whether fluoride resistance correlates with virulence potential

    • Examine CrcB2 expression during infection models

    • Investigate potential links to stress response networks

Previous studies have demonstrated differences in competitive growth between Listeria species in selective media, with lineage 2 L. monocytogenes strains showing different competitive abilities compared to lineage 1 strains when grown with L. innocua . These findings suggest that membrane protein variations may contribute to both ecological fitness and potentially pathogenic potential.

What advanced structural biology techniques are recommended for investigating the three-dimensional structure of CrcB homolog 2?

Investigating the three-dimensional structure of membrane proteins like CrcB homolog 2 presents unique challenges requiring specialized approaches:

Recommended Structural Biology Techniques:

Experimental Design Considerations:

TechniqueSample RequirementsResolution RangeSpecial Considerations
X-ray Crystallography5-10 mg purified protein1.5-3.5 ÅScreen multiple crystallization conditions
Cryo-EM3-5 mg purified protein2.5-4 ÅConsider protein size limitations
Solution NMR15N/13C labeled protein, 5-10 mg3-5 ÅLimited to proteins <25-30 kDa
Solid-state NMR2D crystals or reconstituted samples3-5 ÅNo size limitation but complex interpretation
Integrative approachesVaries by techniqueN/ACombines multiple data sources

For optimal results, a multi-technique approach is recommended, where low-resolution models from computational prediction or SAXS guide experimental design for higher-resolution techniques like cryo-EM or X-ray crystallography. The structural insights gained would significantly advance understanding of fluoride transport mechanisms in bacteria.

What are the emerging research directions for Listeria CrcB homolog proteins in microbial physiology and pathogenesis studies?

Emerging research on Listeria CrcB homolog proteins presents several promising directions that integrate molecular microbiology, structural biology, and pathogenesis:

  • Systems Biology Integration:

    • Mapping CrcB2 within the broader regulatory networks responding to environmental stress

    • Investigating potential moonlighting functions beyond fluoride transport

    • Developing predictive models of bacterial adaptation based on CrcB functionality

  • Host-Pathogen Interaction Studies:

    • Exploring whether CrcB homologs contribute to survival within host phagocytes

    • Investigating potential roles in biofilm formation and persistence

    • Determining if fluoride transport affects virulence gene expression

  • Drug Discovery Applications:

    • Targeting CrcB homologs as novel antimicrobial targets

    • Developing selective inhibitors of bacterial fluoride channels

    • Exploring combination therapies that disrupt ion homeostasis

  • Ecological and Evolutionary Studies:

    • Investigating the distribution and diversity of CrcB variants across environmental niches

    • Examining horizontal gene transfer patterns of fluoride resistance determinants

    • Exploring co-evolution with other ion transport systems

  • Synthetic Biology Applications:

    • Engineering fluoride-responsive biosensors using CrcB components

    • Developing bacterial chassis with enhanced fluoride resistance for bioremediation

    • Creating tunable gene expression systems controlled by fluoride levels

The differentiation of CrcB homologs between pathogenic and non-pathogenic Listeria species, such as L. monocytogenes and L. innocua, provides a valuable model system for investigating how membrane transport proteins contribute to bacterial adaptation and potentially to virulence mechanisms . The study of these proteins intersects with broader questions of bacterial stress responses, environmental adaptation, and host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.