Recombinant Listeria innocua serovar 6a Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced in Escherichia coli with an N-terminal His tag for affinity purification . Key specifications include:

ParameterDetail
Expression SystemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with 5–50% glycerol for long-term storage
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Role in the Tat Pathway

The Tat system in Listeria facilitates the secretion of folded proteins, including virulence factors in pathogenic species like L. monocytogenes. While L. innocua is non-pathogenic, studying its TatC provides insights into conserved mechanisms .

Functional Insights

  • Genetic Context: The tatC gene (locus tag: lin0380) is cotranscribed with tatA in a growth-phase-dependent manner, downregulated during stationary phase .

  • Mutant Studies: Deletion of tatAC in L. monocytogenes increased murine virulence, suggesting regulatory roles beyond secretion .

Applications

  • Mechanistic Studies: Used to probe Tat complex assembly and substrate recognition .

  • Antibody Development: Serves as an antigen for generating anti-TatC antibodies .

  • Biotechnological Tools: Potential use in engineered secretion systems for industrial enzymes .

Comparative Analysis

While L. innocua TatC shares homology with L. monocytogenes TatC (UniProt: Q92ES8 vs. P54078), its non-pathogenic nature makes it a safer model for structural analyses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tatC; lin0380; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
tatC
Target Protein Sequence
MTEVSMSLTGHLKELRTRLLIILLSFFLAFFVGLFVSKPLILFLQKDDLPKEVILHVFKV TDAFQIYIEMAFIIGLILVFPVILYQLWAFVKPGLHASEQRITLRYIPITFLLFLCGVVF SYVITFPFILKFMFQFAAELGVETTIGLATYFQFLLQIVLSFGVLFELPMVIMLLTRLSL ITPNGMRRARKYAYFCLLIIAAFIAPPEILSHLMITIPLIGLYEISIVVSGFTVRRMDKE MNMKKML
Uniprot No.

Target Background

Function
A component of the twin-arginine translocation (Tat) system, this protein transports large, folded proteins across membranes. These proteins possess a characteristic twin-arginine motif within their signal peptide.
Database Links

KEGG: lin:lin0380

STRING: 272626.lin0380

Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the TatC protein and its role in the Tat pathway?

TatC is a polytopic membrane protein that forms the core of the Tat receptor complex in the twin arginine transport (Tat) pathway. This pathway exports folded proteins across the cytoplasmic membranes of prokaryotes and the thylakoid membranes of chloroplasts. Unlike the Sec system, the Tat pathway secretes proteins in their final conformation rather than in an unfolded state .

In Listeria innocua serovar 6a, TatC functions as part of the Sec-independent protein translocase system, facilitating the movement of specific folded proteins across the bacterial membrane. The protein contains multiple transmembrane helices that are critical for its function in substrate recognition and transport initiation .

What are the recommended methods for expressing and purifying recombinant Listeria innocua TatC protein?

For effective expression and purification of recombinant Listeria innocua TatC, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression. Using a pET-based vector with a cleavable His-tag facilitates purification while allowing subsequent tag removal.

  • Induction Conditions: Optimal expression typically occurs at lower temperatures (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) to prevent inclusion body formation.

  • Membrane Extraction: Efficient extraction requires detergents suitable for membrane proteins. A two-step solubilization using mild detergents (DDM, LMNG, or C12E8) preserves protein structure and function.

  • Purification Process:

    • Initial capture via IMAC (immobilized metal affinity chromatography)

    • Secondary purification using size exclusion chromatography

    • Optional ion exchange chromatography for higher purity

  • Storage Conditions: Purified TatC should be maintained in a buffer containing 20 mM Tris-HCl (pH 7.5-8.0), 150 mM NaCl, 10% glycerol, and a concentration of detergent just above its critical micelle concentration .

How can researchers effectively design genetic knockout studies to investigate TatC function in Listeria?

When designing genetic knockout studies for TatC in Listeria species, researchers should implement this methodological framework:

  • Deletion Strategy Selection:

    • Non-polar deletion to prevent downstream effects on the tatA gene

    • Construction of both single (ΔtatC) and complete pathway (ΔtatAC) knockouts for comprehensive functional analysis

  • Vector Construction:

    • Using temperature-sensitive plasmids with appropriate antibiotic resistance markers

    • Including homologous flanking regions (500-1000 bp) for efficient recombination

  • Confirmation Methods:

    • PCR verification of gene deletion

    • RT-PCR analysis to confirm absence of transcription

    • Western blot analysis to verify protein absence

    • Complementation studies to validate phenotype causality

  • Phenotypic Evaluation:

    • Growth curve analysis under various conditions (temperature, pH, salt stress)

    • In vitro and in vivo virulence assessments

    • Protein secretion profiling to identify Tat-dependent substrates

Previous studies with L. monocytogenes demonstrated that ΔtatAC mutants maintain normal growth rates but exhibit altered virulence potential in vivo, with mutants surprisingly showing increased virulence compared to wild-type strains .

What techniques are most effective for studying TatC binding interactions with TatA and TatB proteins?

Researchers investigating the binding interactions between TatC and its partners (TatA/TatB) should consider these methodological approaches:

  • In Vivo Crosslinking:

    • Site-specific incorporation of photo-crosslinkable amino acids

    • Formaldehyde or DSP (dithiobis(succinimidyl propionate)) crosslinking followed by co-immunoprecipitation

    • DSSO (disuccinimidyl sulfoxide) for mass spectrometry-compatible crosslinking

  • Förster Resonance Energy Transfer (FRET):

    • Fusion of fluorescent proteins to Tat components

    • Measurement of energy transfer as indicator of protein proximity

    • Time-resolved FRET for dynamic interaction studies

  • Bacterial Two-Hybrid Analysis:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system for membrane protein interaction studies

    • Split-GFP complementation assays for visualization of interactions

  • Site-Directed Mutagenesis:

    • Systematic mutation of TatC transmembrane helices 5 and 6 (known binding regions)

    • Functional assessment of binding site mutants

    • Correlation of binding defects with transport activity

Research has identified two key binding sites on TatC: a "polar cluster" formed by transmembrane helices 5 and 6 that interacts with TatB in the resting state and exchanges for TatA during activation, and a second site further along transmembrane helix 6 that binds TatA in the resting state .

How does the Tat pathway contribute to Listeria virulence and bacterial fitness?

The relationship between the Tat pathway and Listeria virulence presents an intriguing paradox:

What are the differences in Tat pathway composition and function between Listeria innocua and pathogenic Listeria species?

Understanding the distinctions between Tat pathways in Listeria innocua and pathogenic Listeria species provides insights into virulence mechanisms:

  • Genetic Organization:

    • Both Listeria innocua and Listeria monocytogenes encode tatC and tatA genes in close proximity

    • In L. monocytogenes strain EGDe, these correspond to lmo0361 (tatC) and lmo0362 (tatA)

    • The genetic context and organization are largely conserved between species

  • Pathway Composition:

    • Both species utilize a minimalist Tat system consisting of only TatA and TatC components

    • This differs from the more complex TatA/TatB/TatC system found in many Gram-negative bacteria like E. coli

    • The absence of a distinct TatB component suggests functional adaptation of the remaining components

  • Functional Implications:

    • The non-pathogenic L. innocua serves as an important comparative model for understanding Tat pathway evolution

    • Differences in Tat-dependent secreted proteins may contribute to the distinct ecological niches and pathogenic potential

    • L. innocua TatC may recognize a different subset of proteins compared to its pathogenic counterparts

  • Evolutionary Considerations:

    • The conservation of the Tat pathway despite its non-essential nature suggests it provides selective advantages under specific environmental conditions

    • Comparative genomic analyses between Listeria species could reveal adaptations of the Tat machinery to different lifestyles

What computational methods are recommended for predicting TatC structure and substrate interactions?

Advanced computational approaches for analyzing TatC structure and substrate interactions include:

  • Homology Modeling and Threading:

    • Template identification using HHpred or SWISS-MODEL

    • Refinement with molecular dynamics to accommodate membrane environment

    • Validation through Ramachandran plot analysis and QMEAN scoring

  • Molecular Dynamics Simulations:

    • All-atom simulations in explicit membrane environments (POPC or mixed lipid bilayers)

    • Coarse-grained simulations for longer timescales using MARTINI force field

    • Enhanced sampling techniques (metadynamics, umbrella sampling) to explore conformational changes

  • Binding Site Prediction:

    • FTMap or SiteMap for identifying potential binding pockets

    • Electrostatic surface mapping using APBS to identify charge-complementary regions

    • Molecular docking of twin-arginine signal peptides using HADDOCK or Rosetta

  • System-Specific Considerations:

    • Integration of crosslinking constraints from experimental data

    • Analysis of co-evolving residues to identify interaction networks

    • Simulation of membrane protein assembly using specialized tools like CATM (Coarse-grained Association of Transmembrane proteins)

How does the lipid environment affect TatC function and what methods can be used to study these interactions?

The lipid environment critically influences TatC function through multiple mechanisms that can be studied using these approaches:

  • Lipid Composition Effects:

    • Reconstitution in defined proteoliposomes with varying lipid compositions

    • Analysis of anionic lipid (phosphatidylglycerol, cardiolipin) requirements

    • Manipulation of membrane thickness and fluidity to assess hydrophobic matching effects

  • Experimental Approaches:

    • Fluorescence anisotropy to measure membrane fluidity around TatC

    • Hydrogen-deuterium exchange mass spectrometry to identify lipid-protected regions

    • Native mass spectrometry for direct detection of bound lipids

    • Solid-state NMR for detailed lipid-protein interaction mapping

  • Molecular Dynamics Applications:

    • Identification of specific lipid binding sites and annular lipid shells

    • Analysis of lipid-induced conformational changes

    • Calculation of lateral pressure profiles and their effects on TatC stability

  • Functional Correlation:

    • Transport assays in proteoliposomes with defined lipid compositions

    • Substrate binding studies in different membrane environments

    • Assessment of complex formation efficiency under varying lipid conditions

Understanding these interactions is crucial as membrane properties can significantly influence the conformational changes required for TatC function during protein translocation .

What are the key features of twin-arginine signal peptides recognized by the TatC protein?

The recognition of twin-arginine signal peptides by TatC involves several critical determinants:

  • Core Twin-Arginine Motif:

    • The consensus sequence S/T-R-R-x-F-L-K (where x is any polar amino acid)

    • The twin-arginine (RR) dipeptide is essential for recognition

    • Mutations of either arginine typically abolish transport

  • Tripartite Structure:

    • N-terminal positively charged domain (n-region)

    • Hydrophobic core domain (h-region) with moderate hydrophobicity

    • C-terminal polar domain (c-region) containing the cleavage site

  • Distinguishing Features from Sec Signal Peptides:

    • Generally longer (30-58 amino acids vs. 18-26 for Sec signals)

    • Less hydrophobic h-region

    • More basic n-region

    • Specific avoidance of hydrophobicity patterns that trigger SRP-dependent targeting

  • Species-Specific Variations:

    • Gram-positive bacteria like Listeria may have subtle variations in the consensus motif

    • The context surrounding the twin-arginine motif can influence recognition efficiency

    • Secondary structural elements in the signal peptide may play a role in species-specific recognition

What is the current model for the mechanism of protein translocation through the Tat pathway?

The current mechanistic model for Tat-dependent protein translocation involves several discrete steps:

  • Initial Substrate Recognition:

    • Twin-arginine signal peptide binding to the TatC component

    • Deep insertion of the signal peptide into the TatBC receptor complex

    • Verification of protein folding status through poorly understood quality control mechanisms

  • Receptor Complex Reorganization:

    • Substrate binding triggers conformational changes in the receptor complex

    • TatB occupies the "polar cluster" binding site on TatC in the resting state

    • Upon activation, TatA exchanges with TatB at this binding site

  • Transport Channel Assembly:

    • Recruitment of additional TatA protomers to form the active translocon

    • Assembly of TatA into a size-variable oligomeric structure

    • Channel size adaptation to accommodate various substrate dimensions

  • Translocation Process:

    • Passage of folded substrate through the membrane without compromising barrier function

    • Possible involvement of localized membrane weakening or thinning

    • Energy for translocation derived from the proton motive force (Δp)

  • Signal Peptide Processing and Release:

    • Cleavage of the signal peptide by signal peptidase on the trans side of the membrane

    • Release of mature protein

    • Disassembly of the translocon and return to resting state

This process represents a unique translocation mechanism that accommodates folded proteins of varying sizes while maintaining membrane integrity .

How might the Tat pathway be exploited for biotechnological applications or antimicrobial development?

The unique properties of the Tat pathway present several opportunities for biotechnological applications and antimicrobial development:

  • Recombinant Protein Production:

    • Engineering of Tat-dependent secretion systems for the export of correctly folded heterologous proteins

    • Development of signal peptide variants with enhanced transport efficiency

    • Creation of host strains with optimized Tat pathway components for industrial protein production

  • Vaccine Development:

    • Utilization of attenuated Listeria strains with modified Tat pathways as vaccine vectors

    • The surprising finding that tat mutants exhibit increased virulence suggests careful pathway modulation could enhance immunogenicity

    • Design of Tat-dependent antigen display systems for improved immune presentation

  • Antimicrobial Strategies:

    • Identification of small molecules that inhibit TatC function or TatA-TatC interactions

    • Development of peptidomimetics that compete with twin-arginine signal peptides

    • Creation of decoy substrates that jam the Tat machinery

  • Diagnostic Applications:

    • Design of biosensors using Tat-dependent reporter systems

    • Development of screening methods for Tat pathway inhibitors

    • Creation of diagnostic tools for detecting pathogenic Listeria species based on Tat pathway differences

What are the current gaps in understanding TatC function and what experimental approaches could address them?

Several significant knowledge gaps remain in our understanding of TatC function that require innovative experimental approaches:

  • Structural Determination Challenges:

    • High-resolution structures of TatC in different conformational states are needed

    • Cryo-electron microscopy of the assembled Tat translocon during active translocation

    • Solid-state NMR studies of TatC in native-like membrane environments

  • Quality Control Mechanisms:

    • How the Tat system distinguishes folded from unfolded substrates remains unclear

    • Development of substrates with tunable folding states could probe this mechanism

    • Single-molecule FRET studies to observe conformational sampling during substrate evaluation

  • Energy Coupling:

    • The precise mechanism by which the proton motive force drives translocation is unknown

    • Implementation of controlled proton gradient systems in reconstituted proteoliposomes

    • Site-specific incorporation of pH-sensitive fluorophores to track proton movement

  • Species-Specific Variations:

    • Comparative studies between Listeria innocua and pathogenic Listeria species

    • Identification of the complete set of Tat-dependent substrates in different Listeria species

    • Investigation of how Tat pathway composition influences substrate specificity and function

  • Regulatory Networks:

    • Mapping of transcriptional and post-translational regulation of the Tat pathway

    • Analysis of growth-phase dependent expression observed in previous studies

    • Investigation of environmental signals that modulate Tat activity

What controls and validations should be included in experimental studies of TatC function?

Robust experimental design for TatC functional studies must include these critical controls and validations:

  • Genetic Validation:

    • Complementation of deletion mutants to confirm phenotype specificity

    • Site-directed mutagenesis controls targeting conserved residues

    • Use of both single (ΔtatC) and complete pathway (ΔtatAC) deletions for comprehensive analysis

  • Expression Verification:

    • Western blot analysis with specific antibodies to confirm protein levels

    • RT-qPCR for transcript quantification

    • Fluorescent fusion reporters to track protein localization and expression in real-time

  • Functional Assays:

    • Transport assays using known Tat substrates as positive controls

    • Sec-dependent substrates as negative controls

    • Assessment of membrane integrity to rule out non-specific effects

  • Structural Integrity:

    • Circular dichroism to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal stability assays to evaluate structural robustness

  • System-Specific Considerations:

    • Comparison with related Listeria species to identify conserved functions

    • Testing under various environmental conditions relevant to Listeria ecology

    • Consideration of growth phase effects on Tat pathway activity

How should researchers interpret contradictory findings in Tat pathway studies across different bacterial species?

The interpretation of contradictory findings in Tat pathway studies requires careful consideration of several factors:

  • Evolutionary Diversity Considerations:

    • The Tat system shows considerable diversity across bacterial phyla

    • Gram-negative bacteria typically possess TatA, TatB, and TatC components

    • Gram-positive bacteria, including Listeria, often lack a separate TatB protein

    • These compositional differences likely reflect functional adaptations

  • Methodological Variations:

    • Different experimental approaches may yield apparently contradictory results

    • In vivo versus in vitro studies may not always align

    • Growth conditions significantly impact Tat-dependent phenotypes

  • Substrate Repertoire Differences:

    • The complement of Tat-dependent proteins varies widely between species

    • Essential versus non-essential functions of the pathway correlate with substrate profiles

    • Species-specific substrate dependencies explain varying phenotypic consequences of pathway disruption

  • Contextual Framework for Interpretation:

    • Develop a hierarchical model of conservation (core functions vs. species-specific adaptations)

    • Consider ecological niche and lifestyle of the organism when interpreting results

    • Evaluate findings in the context of membrane composition and cellular physiology

  • Reconciliation Strategies:

    • Direct comparative studies using standardized methodologies

    • Heterologous expression experiments to test component exchangeability

    • Chimeric protein approaches to identify species-specific functional domains

The surprising finding that Tat pathway deletion in Listeria monocytogenes increases virulence, contrasting with attenuation in other pathogens, exemplifies how species-specific adaptations can lead to seemingly contradictory outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.