Recombinant Listeria innocua serovar 6a Uncharacterized protein Lin0175 (lin0175)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lin0175; Uncharacterized protein Lin0175
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
lin0175
Target Protein Sequence
MEIILKIGILGFGAVFGYLFGEVDLLVKVLVCFIVADYISGLLASGYLGELSSKMGFKGI AKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILENFVRMGMKVPEVLKNL ILIFDAKSGDEEEKHDKDMD
Uniprot No.

Target Background

Database Links

KEGG: lin:lin0175

STRING: 272626.lin0175

Protein Families
Cp-1 holin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria innocua and how does it relate to pathogenic Listeria species?

Listeria innocua is a non-pathogenic bacterial species belonging to the genus Listeria. Unlike its pathogenic relative Listeria monocytogenes, L. innocua lacks key virulence factors necessary for causing disease. Genomic characterization studies have revealed that L. innocua isolates can be recovered from diverse sources including cattle farms, beef abattoirs, and retail outlets, making it an environmentally ubiquitous organism . Despite being non-pathogenic, L. innocua shares significant genomic similarities with pathogenic Listeria species, particularly in housekeeping genes and certain metabolic pathways. This genetic relationship makes L. innocua valuable for comparative studies examining the evolution of virulence in the Listeria genus. Recent whole-genome sequencing (WGS) analyses have identified multiple sequence types (STs) among L. innocua isolates, with ST637, ST448, ST537, and ST1085 being predominant in certain geographical regions .

How should researchers plan experiments to characterize uncharacterized proteins like Lin0175?

Characterizing uncharacterized proteins requires a systematic experimental approach combining multiple techniques. When designing experiments for Lin0175 characterization, researchers should implement the following methodology:

  • Begin with sequence analysis using bioinformatics tools to identify:

    • Conserved domains and motifs

    • Potential structural features

    • Evolutionary relationships with characterized proteins

  • Design expression experiments using appropriate vectors and host systems:

    • Select expression systems compatible with bacterial proteins

    • Optimize codons for the host organism

    • Include purification tags (such as the His-tag already incorporated in the recombinant Lin0175)

  • Implement a structured experimental design approach:

    • Use Completely Randomized Design (CRD) for initial screening experiments where environmental factors can be tightly controlled

    • Progress to Randomized Block Design (RBD) when accounting for variation sources becomes necessary

    • Consider Latin Square Design (LSD) when controlling for two distinct sources of variation simultaneously

  • Plan functional characterization through multiple complementary approaches:

    • Protein-protein interaction studies

    • Subcellular localization experiments

    • Comparative studies with related proteins in pathogenic Listeria species

This stepwise approach ensures methodological rigor when characterizing uncharacterized proteins like Lin0175.

What experimental design is most appropriate for studying Lin0175 protein function?

The optimal experimental design for studying Lin0175 protein function depends on the specific research question and available resources. Based on established experimental design principles, the following approaches are recommended:

Experimental DesignApplication for Lin0175 ResearchAdvantagesLimitations
Completely Randomized Design (CRD)Initial screening of Lin0175 function under controlled laboratory conditionsSimple implementation; statistical analysis is straightforward; well-suited for homogeneous experimental material Less efficient when experimental units have inherent variability; may require more replicates
Randomized Block Design (RBD)Testing Lin0175 function across different environmental conditions or genetic backgroundsReduces experimental error by controlling for known sources of variation; more powerful than CRD when blocks are homogeneous Requires identification of relevant blocking factors; analysis becomes complex with unequal replication
Latin Square Design (LSD)Studying Lin0175 interactions with multiple factors (e.g., temperature, pH, salt concentration)Controls two sources of variation simultaneously; can substantially reduce error variance Limited to equal numbers of treatments and blocking factors; becomes unwieldy with many treatments

For initial characterization of Lin0175, a Completely Randomized Design with adequate replication would provide a foundation for subsequent more complex experimental designs. As knowledge about potential influencing factors accumulates, researchers should transition to blocked designs that control for identified sources of variation.

What purification strategies are recommended for recombinant Lin0175 protein?

Purification of recombinant Lin0175 protein should leverage the His-tag already incorporated in the available recombinant form . The following purification strategy is recommended:

  • Initial capture using Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or cobalt-based resins with binding capacity appropriate for bacterial lysates

    • Implement a step gradient elution protocol to separate weakly bound contaminants

    • Monitor purification efficiency using SDS-PAGE analysis of elution fractions

  • Secondary purification steps:

    • Size Exclusion Chromatography (SEC) to separate monomeric Lin0175 from aggregates and other contaminants

    • Ion Exchange Chromatography (IEX) if charge-based separation is needed for removal of specific contaminants

  • Quality control assessment:

    • Analyze protein purity using high-resolution analytical techniques

    • Verify protein identity through mass spectrometry or N-terminal sequencing

    • Assess structural integrity through circular dichroism or thermal shift assays

Optimizing buffer conditions throughout the purification process is critical, as uncharacterized proteins may have unknown stability requirements. A systematic approach testing multiple buffer systems (varying pH, salt concentration, and stabilizing additives) should be employed to identify conditions that maximize protein stability and yield.

How can researchers effectively analyze Lin0175 gene expression across different conditions?

Analyzing Lin0175 gene expression requires a systematic approach combining multiple techniques to generate robust, reproducible data. The recommended methodology includes:

  • Experimental design considerations:

    • Implement a Randomized Block Design to control for batch effects and other sources of variation

    • Include appropriate biological and technical replicates (minimum three biological replicates)

    • Design time-course experiments to capture expression dynamics

  • RNA isolation and quality control:

    • Use specialized protocols optimized for Gram-positive bacteria like Listeria

    • Verify RNA integrity using electrophoretic methods before proceeding

    • Remove genomic DNA contamination through enzymatic treatment

  • Expression analysis methods:

    • Quantitative PCR (qPCR) for targeted analysis of Lin0175

    • RNA-Seq for genome-wide expression context

    • Northern blotting for validation of transcript size and stability

  • Data analysis and presentation:

    • Normalize expression data to stable reference genes validated for Listeria

    • Apply appropriate statistical tests based on experimental design

    • Present findings using clear tables and figures that are self-explanatory

When presenting gene expression data, researchers should ensure tables and figures are self-explanatory, with clear titles, labels, and formatting . The text should highlight key points and significance without duplicating exact values, maintaining consistency between tables/figures and the main text .

How does Lin0175 compare to virulence-associated proteins in pathogenic Listeria species?

The relationship between Lin0175 in Listeria innocua and virulence-associated proteins in pathogenic Listeria species represents an important research direction for understanding bacterial pathogenicity evolution. Comparative genomic analyses reveal several important considerations:

While specific information about Lin0175 homologs in pathogenic Listeria is limited, genomic characterization studies of L. innocua have identified numerous virulence genes that are typically associated with pathogenic species . A comprehensive analysis could determine whether Lin0175 belongs to this category of proteins that are conserved between pathogenic and non-pathogenic Listeria species.

Recent studies have identified 23 different virulence genes in L. innocua isolates, suggesting that the traditional distinction between pathogenic and non-pathogenic Listeria species may be more complex than previously understood . Researchers should consider Lin0175 within this context, investigating whether it may play a role in environmental adaptation rather than direct virulence.

To effectively study this relationship, researchers should:

  • Perform comprehensive sequence alignment and phylogenetic analysis to identify Lin0175 homologs in pathogenic Listeria species

  • Compare expression patterns of Lin0175 and its homologs across different environmental conditions

  • Conduct functional studies using gene deletion and complementation to determine the physiological role of Lin0175

  • Utilize structural biology approaches to identify potential functional domains that might relate to virulence factors

This comparative approach provides critical insights into the evolutionary relationship between Lin0175 and virulence-associated proteins in pathogenic Listeria species.

What role might Lin0175 play in antimicrobial resistance in Listeria innocua?

The potential role of Lin0175 in antimicrobial resistance represents an important research question, particularly given the widespread detection of resistance genes in Listeria innocua isolates. Recent genomic characterization studies have revealed that all analyzed L. innocua isolates carried one or more antimicrobial resistance genes, with the lin gene family being notably present . Though direct evidence linking Lin0175 to antimicrobial resistance mechanisms is not established, several research approaches can address this question:

  • Comparative expression analysis:

    • Measure Lin0175 expression levels in response to antibiotic exposure

    • Compare expression patterns between antibiotic-resistant and sensitive strains

    • Identify potential co-expression networks involving known resistance genes

  • Functional characterization:

    • Generate Lin0175 knockout mutants and assess changes in antibiotic susceptibility

    • Perform complementation studies to confirm phenotypic associations

    • Conduct protein-protein interaction studies to identify associations with known resistance mechanisms

  • Structural analysis:

    • Identify potential binding pockets that could interact with antimicrobial compounds

    • Compare structural features with known resistance proteins

    • Utilize molecular docking simulations to predict potential interactions with antibiotics

The systematic investigation of Lin0175's potential role in antimicrobial resistance could provide valuable insights into resistance mechanisms in non-pathogenic Listeria species and their potential as reservoirs of resistance genes.

How can researchers optimize recombinant Lin0175 expression for structural studies?

Optimizing recombinant Lin0175 expression for structural studies requires addressing several critical factors to ensure high yield, purity, and proper folding. The recommended methodology includes:

  • Expression system selection:

    • Evaluate prokaryotic (E. coli) versus eukaryotic (insect cells, yeast) expression systems

    • Consider cell-free systems for potentially toxic proteins

    • Test multiple expression strains with varying properties (e.g., BL21(DE3), Rosetta, SHuffle)

  • Expression construct optimization:

    • Design constructs with varying N- and C-terminal boundaries

    • Test different fusion partners beyond the His-tag (e.g., MBP, GST, SUMO)

    • Include protease cleavage sites for tag removal if needed for structural studies

  • Expression condition screening:

    • Implement a Latin Square Design to simultaneously evaluate multiple variables (temperature, inducer concentration, media composition)

    • Develop a staged experimental approach, with initial screening followed by optimization

    • Monitor protein solubility rather than total expression level

  • Protein quality assessment:

    • Employ thermal shift assays to assess protein stability

    • Utilize size exclusion chromatography to confirm monodispersity

    • Perform preliminary structural characterization (circular dichroism, small-angle X-ray scattering)

Optimization ParameterVariables to TestAnalytical MethodExpected Outcome
Expression Temperature15°C, 25°C, 37°CSDS-PAGE, Western blotIdentify temperature yielding highest soluble protein
Induction Time4h, 8h, overnightSDS-PAGE, Activity assayDetermine optimal harvest time
Inducer Concentration0.1mM, 0.5mM, 1.0mM IPTGSDS-PAGE, Western blotFind concentration balancing yield and solubility
Media CompositionLB, TB, AutoinductionYield quantificationIdentify media supporting highest expression

This methodical approach to optimization generates recombinant Lin0175 protein suitable for downstream structural biology applications including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

What bioinformatic approaches are most effective for predicting Lin0175 function?

Predicting the function of uncharacterized proteins like Lin0175 requires a multi-faceted bioinformatic approach that integrates diverse computational methods. The recommended strategy includes:

  • Sequence-based analysis:

    • Position-Specific Iterative Basic Local Alignment Search Tool (PSI-BLAST) to identify distant homologs

    • Multiple Sequence Alignment (MSA) to identify conserved residues

    • Hidden Markov Model (HMM) profiles to detect subtle sequence patterns

    • Genome context analysis to identify potentially functionally related genes

  • Structure-based prediction:

    • Secondary structure prediction using machine learning algorithms

    • Ab initio and homology-based tertiary structure modeling

    • Binding site prediction to identify potential functional regions

    • Molecular dynamics simulations to assess structural stability and flexibility

  • Network-based approaches:

    • Gene neighborhood analysis across multiple Listeria genomes

    • Protein-protein interaction prediction

    • Co-expression network analysis from transcriptomic data

    • Phylogenetic profiling to identify co-evolving proteins

  • Functional annotation:

    • Gene Ontology (GO) term prediction

    • Enzyme classification prediction

    • Pathway participation prediction

    • Subcellular localization prediction

This comprehensive bioinformatic strategy provides multiple lines of evidence regarding potential functions, which can then be experimentally validated. The integration of these diverse approaches substantially increases confidence in functional predictions compared to any single method.

How should researchers analyze and present data from comparative studies of Lin0175 across Listeria species?

Analyzing and presenting data from comparative studies of Lin0175 across different Listeria species requires rigorous statistical approaches and effective visualization techniques. Based on established best practices, researchers should implement the following methodology:

  • Experimental design considerations:

    • Employ Latin Square Design when comparing multiple variables across different Listeria species

    • Ensure adequate biological and technical replication

    • Include appropriate controls for each species and condition

  • Statistical analysis approaches:

    • Apply multivariate statistical methods to identify patterns across species

    • Implement phylogenetically-aware statistical approaches to account for evolutionary relationships

    • Use appropriate normalization procedures when comparing expression levels across species

  • Data presentation strategies:

    • Create self-explanatory tables and figures that can be understood without referring to the main text

    • Use tables for precise numerical values and figures for visualizing trends and patterns

    • Maintain consistency between data presented in tables/figures and information in the main text

  • Effective table design:

    • Include clear, informative titles

    • Organize information with appropriate spacing and labels

    • Avoid clutter by including only relevant data

  • Figure optimization:

    • Select appropriate visualization types based on data characteristics

    • Ensure all axes are properly labeled

    • Include informative legends that explain all symbols and abbreviations

Following these guidelines ensures that comparative data on Lin0175 across Listeria species is analyzed rigorously and presented in a manner that maximizes clarity and scientific impact.

How might characterizing Lin0175 contribute to understanding Listeria evolution and adaptation?

Characterizing the uncharacterized protein Lin0175 can provide significant insights into Listeria evolution and adaptation through several research avenues:

The genomic context of Lin0175 in Listeria innocua compared to other Listeria species may reveal evolutionary patterns associated with niche adaptation. Recent genomic characterization studies of L. innocua have identified multiple sequence types with varying prevalence across environmental sources . Investigating whether Lin0175 sequence variation correlates with these sequence types could reveal adaptive signatures related to specific environmental niches.

Comparative genomic analyses can determine whether Lin0175 represents a conserved ancestral protein or a more recently evolved protein specific to non-pathogenic Listeria lineages. This evolutionary context is particularly important given that L. innocua isolates have been found to carry various virulence genes typically associated with pathogenic species, suggesting complex evolutionary relationships .

Functional characterization of Lin0175 may reveal roles in stress response, metabolic adaptation, or other processes critical for environmental persistence. This functional information could help explain how different Listeria species have adapted to various ecological niches and provide insights into the evolutionary trajectories that led to the divergence of pathogenic and non-pathogenic Listeria species.

Future research directions should include:

  • Comparative transcriptomic analysis of Lin0175 expression across diverse environmental conditions

  • Investigation of Lin0175 sequence variation across geographically diverse L. innocua isolates

  • Experimental evolution studies to track Lin0175 adaptation under selective pressures

  • Structural studies to identify potential binding partners and functional domains

These approaches would significantly enhance our understanding of how Lin0175 contributes to Listeria evolution and adaptation.

What are the most promising future research directions for understanding Lin0175 function?

The path forward for understanding Lin0175 function requires an integrated approach combining multiple experimental strategies. The most promising research directions include:

  • Structural biology approaches:

    • X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

    • Nuclear Magnetic Resonance (NMR) spectroscopy to analyze dynamics and binding interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and binding interfaces

  • Systems biology integration:

    • Transcriptomic profiling of Lin0175 deletion mutants under various conditions

    • Metabolomic analysis to identify biochemical pathways affected by Lin0175

    • Protein interaction network mapping using approaches like proximity labeling

  • Comparative studies:

    • Functional comparison between Lin0175 and homologs in pathogenic Listeria species

    • Heterologous expression studies in model organisms to assess phenotypic effects

    • Evolutionary analysis across the Firmicutes phylum to identify conserved functional motifs

  • Applied research directions:

    • Investigation of Lin0175's potential role in antimicrobial resistance mechanisms

    • Assessment of Lin0175 as a potential biomarker for specific L. innocua sequence types

    • Exploration of potential biotechnological applications based on identified functions

These research directions represent complementary approaches that, when integrated, can provide a comprehensive understanding of Lin0175 function. Researchers should prioritize these directions based on available resources and specific research questions while maintaining awareness of how each approach contributes to the broader understanding of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.