Recombinant Listeria innocua serovar 6a UPF0154 protein lin1344 (lin1344)

Shipped with Ice Packs
In Stock

Description

Manufacturing Process

  • Recombinant Expression: Engineered in E. coli using synthetic DNA constructs.

  • Purification: Affinity chromatography (e.g., nickel-NTA columns for His-tagged proteins) .

  • Buffer Composition: Tris-based buffer with 50% glycerol to enhance stability .

Potential Use Cases

  • Protein Studies: Investigating UPF0154 family functions, as L. innocua lacks virulence factors like inlA and inlB .

  • Diagnostic Tools: ELISA assays for detecting L. innocua in food or environmental samples .

  • Functional Genomics: Exploring roles in bacterial physiology (e.g., stress response, adhesion).

Knowledge Gaps

  1. Functional Annotation: No published studies link lin1344 to specific biochemical pathways, adhesion mechanisms, or stress responses.

  2. Interactions: No reported protein-protein interactions or binding partners .

  3. Comparative Genomics: Limited data on orthologs in other Listeria species or bacterial genera.

UPF0154 Family Context

Featurelin1344Other UPF0154 Proteins
Sequence Length79 aaVariable (50–100 aa)
Functional ClassificationUncharacterizedHypothetical proteins
Taxonomic DistributionListeria innocuaBroad bacterial phyla

Contrast with Pathogenic Listeria monocytogenes

  • Virulence Genes: L. innocua lacks LIPI-1 (listeria pathogenicity island 1) and inlA/B, which are critical for L. monocytogenes pathogenesis .

  • Plasmid Content: Some L. innocua isolates carry plasmids with clpL (heat resistance), but lin1344 is chromosomally encoded .

Future Research Directions

  1. Functional Screens: CRISPR knockout studies in L. innocua to identify phenotypic changes.

  2. Structural Biology: X-ray crystallography or cryo-EM to resolve 3D structure.

  3. Omic Integration: Metagenomic or transcriptomic studies to map expression patterns.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please specify your desired format during the order process, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life can be influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lin1344; UPF0154 protein lin1344
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-79
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
lin1344
Target Protein Sequence
MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK
Uniprot No.

Target Background

Database Links

KEGG: lin:lin1344

STRING: 272626.lin1344

Protein Families
UPF0154 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Listeria innocua and how does it relate to pathogenic Listeria species?

Listeria innocua is a Gram-positive rod-shaped bacterium that is generally non-infectious, unlike its pathogenic relative Listeria monocytogenes. Despite their distinct pathogenicity profiles, these species share high genomic similarity and often coexist in similar ecological niches, which presents opportunities for resistance or virulence gene transfer between them . L. innocua has been isolated from various food sources, including dairy products, and multiple sequence types have been identified through multilocus sequence typing (MLST) .

What is UPF0154 protein lin1344 and which protein family does it belong to?

The UPF0154 protein lin1344 is a protein encoded by the lin1344 gene in Listeria innocua serovar 6a. It belongs to the UPF0154 protein family, which consists of proteins with unknown functions that are conserved across multiple bacterial species. The "UPF" designation indicates "Uncharacterized Protein Family," suggesting that the precise biological function of this protein has not been fully elucidated. Studying recombinant forms of this protein allows researchers to investigate its structure, function, and potential roles in bacterial physiology.

How is the genome of Listeria innocua typically characterized?

Listeria innocua genomes are characterized through whole-genome sequencing techniques. Modern approaches include library preparation methods such as using the DNA Prep kit (Illumina) followed by sequencing on platforms like the Illumina MiSeq instrument . The assembled genomes typically include both chromosomal DNA and plasmids. For instance, complete genome sequencing of L. innocua isolates has revealed that some strains contain one chromosome and one plasmid (e.g., LI42 and LI203), while others may have one chromosome and multiple plasmids (e.g., LI47 with two plasmids) . The median genome size for L. innocua isolates has been reported as approximately 2.84 Mbp with a median N50 of 0.75 Mbp .

What expression systems are most effective for producing recombinant lin1344 protein?

For recombinant expression of Listeria proteins including lin1344, Escherichia coli-based expression systems are commonly employed due to their efficiency and scalability. The choice of expression vector depends on the research objectives:

Table 1. Common Expression Systems for Recombinant Listeria Proteins

Expression SystemAdvantagesLimitationsBest For
pET vectors (E. coli)High expression levels, induciblePotential inclusion body formationStructural studies, antibody production
pGEX vectors (E. coli)GST fusion for solubility, single-step purificationLarger fusion tagProtein-protein interaction studies
pMAL vectors (E. coli)MBP fusion enhances solubilityLarger fusion proteinDifficult-to-express proteins
Bacillus subtilis systemsBetter for secreted proteinsLower yields than E. coliProteins toxic to E. coli
Listeria-based expressionNative post-translational modificationsMore complex genetic manipulationFunctional studies requiring native conditions

When expressing lin1344, it's crucial to optimize induction conditions (temperature, inducer concentration, and duration) to maximize soluble protein yield. Since UPF0154 family proteins may have varying solubility profiles, preliminary small-scale expression trials are recommended to determine optimal conditions.

What purification strategies yield the highest purity for recombinant lin1344?

Purification of recombinant lin1344 typically involves a multi-step approach:

  • Initial capture using affinity chromatography (IMAC for His-tagged proteins)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

The specific properties of lin1344 should guide buffer selection throughout the purification process. Since the isoelectric point and hydrophobicity profile of lin1344 may impact its behavior during purification, it's advisable to perform preliminary characterization to inform buffer composition decisions.

Table 2. Recommended Purification Protocol for Recombinant lin1344

Purification StageTechniqueBuffer ConsiderationsQuality Control
Cell lysisSonication or pressure-basedProtease inhibitors, reducing agentsSDS-PAGE of soluble fraction
CaptureIMAC (for His-tagged)20-50 mM imidazole in wash buffersWestern blot confirmation
IntermediateIon exchangeTest both anion/cation exchangePurity assessment (>85%)
PolishingSize exclusionPhysiological buffersFinal purity check (>95%)
StorageFlash freezing10-20% glycerol, avoid multiple freeze-thawStability testing

How can researchers verify the structural integrity of purified lin1344?

Multiple biophysical techniques should be employed to assess the structural integrity of purified lin1344:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

  • Dynamic light scattering (DLS) to confirm monodispersity

  • Thermal shift assays to evaluate stability

  • Limited proteolysis to identify flexible regions

  • NMR spectroscopy for tertiary structure assessment (for isotopically labeled protein)

Comparing these parameters to other characterized UPF0154 family proteins can provide insights into whether the recombinant protein has folded correctly.

What approaches can determine the biological function of lin1344?

Since UPF0154 proteins have unknown functions, a systematic approach combining multiple techniques is necessary:

  • Comparative genomics: Analyze the genomic context of lin1344 to identify co-regulated genes or conserved operons.

  • Interactome analysis: Employ pull-down assays, co-immunoprecipitation, or bacterial two-hybrid systems to identify protein interaction partners.

  • Gene deletion/complementation: Create knockout mutants followed by phenotypic characterization and complementation studies.

  • Transcriptomics: Perform RNA-seq under various conditions to identify conditions that alter lin1344 expression.

  • Structural biology: Determine the three-dimensional structure through X-ray crystallography or cryo-EM to infer function from structure.

How does lin1344 compare with orthologous proteins in pathogenic Listeria species?

While specific information about lin1344 orthologs is limited in the provided search results, understanding the relationship between L. innocua and L. monocytogenes proteins can inform functional studies. The high genomic similarity between L. innocua and L. monocytogenes (as noted in search result ) suggests potential functional conservation of many proteins between these species.

When analyzing orthologs, researchers should consider:

  • Sequence conservation at both nucleotide and amino acid levels

  • Conservation of key functional domains

  • Differences in expression patterns between species

  • Potential roles in virulence or stress response

What role might lin1344 play in bacterial adaptation or survival?

Without specific functional data on lin1344, researchers should consider several hypotheses based on patterns observed in other bacterial UPF0154 family proteins:

  • Stress response regulation in adverse environmental conditions

  • Involvement in cell wall synthesis or remodeling

  • Roles in nutrient sensing or metabolic regulation

  • Potential contribution to competitive fitness in ecological niches

To test these hypotheses, researchers should design experiments exposing L. innocua to various stress conditions (pH shifts, temperature fluctuations, nutrient limitation) and measure lin1344 expression changes. Additionally, phenotypic characterization of lin1344 deletion mutants under these conditions can provide insights into its function.

How widespread is lin1344 across Listeria species and strains?

Researchers interested in the distribution of lin1344 should conduct comprehensive genomic analyses across Listeria species and strains. While specific data on lin1344 distribution is not provided in the search results, the approach for such analysis would involve:

  • BLAST searches against all sequenced Listeria genomes in public databases

  • Phylogenetic analysis of identified homologs

  • Analysis of sequence conservation and selection pressure

  • Assessment of genomic context conservation

The pangenome analysis of L. innocua isolates has revealed that the species contains approximately 4,440 genes, with 2,434 core genes shared by all studied isolates . Determining whether lin1344 belongs to the core or accessory genome would provide insights into its evolutionary importance.

How do sequence variations in lin1344 correlate with Listeria innocua sequence types?

The search results indicate that L. innocua isolates represent multiple sequence types (STs), including ST 1087, ST 1619, ST 637, ST 537, ST 474, ST 1008, ST 1489, ST 492, ST 3007, ST 603, ST 1010, and novel ST 3186 . Correlation between lin1344 sequence variations and these sequence types could reveal:

  • Evolutionary patterns within the species

  • Potential adaptive significance of lin1344 variants

  • Association with specific ecological niches or isolation sources

Researchers should perform targeted sequencing of lin1344 across diverse L. innocua STs and construct phylogenetic trees to visualize relationships between variants.

Could lin1344 be involved in horizontal gene transfer between Listeria species?

Given that L. innocua and L. monocytogenes share genomic similarities and ecological niches, horizontal gene transfer between these species is possible. Search result notes that "the comparatively high genomic similarity between both along with on occasion, their coexistence in similar ecological niches may present the opportunity for resistance or virulence gene transfer."

To investigate whether lin1344 could be involved in horizontal gene transfer:

  • Analyze GC content and codon usage patterns for evidence of recent transfer

  • Examine flanking regions for mobile genetic elements

  • Compare evolutionary rates with housekeeping genes

  • Search for lin1344 homologs in other bacterial genera

How might structural studies of lin1344 inform antimicrobial development?

UPF0154 family proteins, if found to be essential for bacterial survival or virulence, could represent novel targets for antimicrobial development. Structural studies of lin1344 could:

  • Identify potential ligand-binding pockets

  • Reveal conserved structural features across Listeria species

  • Guide structure-based drug design efforts

  • Illuminate potential mechanisms of action

These studies would be particularly valuable if lin1344 orthologs are present in pathogenic Listeria species like L. monocytogenes but absent or significantly different in humans or beneficial bacteria.

What implications does the presence of pathogenicity islands in L. innocua have for lin1344 research?

Search result indicates that all three L. innocua isolates studied possessed listeria pathogenicity island-4 (LIPI-4), which is linked to cases of meningitis. This finding suggests that some L. innocua strains may harbor virulence factors previously thought to be exclusive to pathogenic species.

For lin1344 research, this raises important questions:

  • Is lin1344 located near or within pathogenicity islands?

  • Does lin1344 expression correlate with virulence factor expression?

  • Could lin1344 play supporting roles in pathogenicity or stress response?

  • How does the genetic context of lin1344 differ between more and less virulent strains?

Further genomic analysis and functional studies are needed to address these questions.

How can researchers overcome solubility issues with recombinant lin1344?

Recombinant proteins from Listeria species can present solubility challenges. If lin1344 shows poor solubility, researchers should consider:

Table 3. Strategies to Improve Recombinant lin1344 Solubility

What analytical techniques best characterize lin1344-protein interactions?

To investigate interactions between lin1344 and other proteins or potential ligands, researchers should employ multiple complementary techniques:

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics and affinity measurements.

  • Isothermal Titration Calorimetry (ITC): Offers thermodynamic parameters of binding interactions.

  • Microscale Thermophoresis (MST): Allows measurement of interactions in complex buffers with minimal protein consumption.

  • Bio-Layer Interferometry (BLI): Enables rapid screening of multiple interaction partners.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps interaction interfaces at the residue level.

Each technique offers distinct advantages, and using multiple approaches provides more robust characterization of interaction properties.

What are the most promising applications of lin1344 research?

Research on lin1344 and other UPF0154 family proteins could contribute to several scientific and applied fields:

  • Fundamental bacterial physiology: Understanding protein function in bacterial adaptation and survival.

  • Comparative genomics: Elucidating evolutionary relationships between Listeria species.

  • Biotechnology applications: Potential development of protein-based biosensors or biocatalysts if unique functional properties are discovered.

  • Food safety: Better understanding of L. innocua may improve detection methods and control strategies for Listeria in food processing environments, as L. innocua is often used as a surrogate for L. monocytogenes .

  • Antimicrobial development: If lin1344 proves essential for bacterial survival, it could represent a novel target for antimicrobial compounds.

How might studying lin1344 contribute to our understanding of Listeria evolution and pathogenicity?

The study of lin1344 could provide insights into the evolutionary relationships between pathogenic and non-pathogenic Listeria species. Search result notes that genome environment and phylogenetic analysis of regions flanking pathogenicity islands in L. innocua and L. monocytogenes suggest common origins with potential for transmission between species.

Understanding the role of proteins like lin1344 in this context could illuminate:

  • Evolutionary paths from non-pathogenic to pathogenic Listeria lineages

  • Mechanisms of horizontal gene transfer and adaptation

  • The genetic basis for the emergence of new virulent strains

  • Potential future evolutionary trajectories of Listeria species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.