Recombinant Listeria innocua serovar 6a UPF0266 membrane protein lin0773 (lin0773)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lin0773; UPF0266 membrane protein lin0773
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Target Names
lin0773
Target Protein Sequence
MVWDATNIFLFIANILTLLYILYNDAVIPLSKGKTVLSVKLRSRGRWDGYIFVGIIVLLF VSNTFFREGPFSTSVLLAVMGVLFIYICFFRSSKAVFKETGLYYALLFFPYAKIERMNLS EDGVLVIETNRQRLMLFARSEKDLEKMLAVFTTYS
Uniprot No.

Target Background

Database Links

KEGG: lin:lin0773

STRING: 272626.lin0773

Protein Families
UPF0266 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lin0773 and what organisms express this protein?

Lin0773 is a UPF0266 family membrane protein expressed in Listeria innocua serovar 6a. It is a relatively small protein consisting of 155 amino acids with the UniProt ID Q92DP0. The protein is classified as part of the UPF0266 family, which contains proteins of unknown function. Listeria innocua is a Gram-positive bacterium that is widely distributed in the environment and food. While generally considered non-pathogenic, there have been rare documented cases of human infection, including a fatal bacteremia case as reported in clinical literature . When working with this protein, researchers should note that while it shares structural similarities with proteins from other Listeria species, its specific function remains under investigation.

How is recombinant Lin0773 typically produced and purified?

Recombinant Lin0773 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The general methodology involves:

  • Cloning the lin0773 gene into an appropriate expression vector

  • Transforming the construct into a compatible E. coli strain

  • Inducing protein expression using IPTG or other inducers

  • Cell lysis and extraction of the membrane protein (using detergents)

  • Purification via Ni-NTA affinity chromatography (utilizing the His-tag)

  • Optional further purification using size exclusion chromatography

The purified protein is often provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Researchers should note that membrane proteins like Lin0773 often require specialized handling during purification to maintain their native conformation, including careful selection of detergents and buffer conditions.

What are the recommended storage conditions for recombinant Lin0773?

For optimal stability and activity, recombinant Lin0773 should be stored at -20°C to -80°C immediately upon receipt. The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Key storage recommendations include:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (recommended final concentration 50%) before aliquoting

  • Storage of working aliquots at 4°C for up to one week

  • Avoidance of repeated freeze-thaw cycles, which can compromise protein integrity

These conditions help preserve the structural integrity and functional properties of the membrane protein during storage periods.

How does Lin0773 relate to other membrane proteins in Listeria species and what evolutionary significance might this have?

Lin0773 belongs to the UPF0266 family of membrane proteins, which are conserved across various bacterial species but particularly in Gram-positive bacteria. When comparing Lin0773 from L. innocua serovar 6a with homologous proteins from other Listeria species, several observations emerge:

  • Sequence analysis between L. innocua and L. monocytogenes shows high conservation of membrane proteins, including Lin0773 homologs

  • 16S rRNA gene sequencing demonstrates that L. innocua and L. monocytogenes share approximately 99.62% sequence similarity

  • Despite their genetic similarity, these species exhibit significant differences in pathogenicity

This high conservation suggests an important functional role for Lin0773, possibly in membrane structure maintenance or transport functions. The evolutionary divergence between pathogenic Listeria species (like L. monocytogenes) and non-pathogenic ones (like L. innocua) makes this protein family particularly interesting for comparative genomic studies. Researchers investigating the evolutionary significance of Lin0773 should consider applying phylogenetic analysis methods to understand how this protein has evolved across Listeria species and whether structural variations correlate with functional differences in pathogenicity or environmental adaptation.

What are the predicted functional domains of Lin0773 and how might they contribute to its biological role?

Based on sequence analysis and comparison with other membrane proteins, Lin0773 likely contains several functional domains:

  • Transmembrane domains: Hydrophobicity analysis suggests the presence of multiple membrane-spanning regions

  • Potential binding sites: Regions that may interact with other cellular components

  • Conserved motifs: Sequence patterns shared with other UPF0266 family members

To investigate these domains experimentally, researchers should consider:

  • Site-directed mutagenesis of conserved residues to assess their importance for function

  • Truncation studies to determine minimal functional domains

  • Protein-protein interaction studies to identify binding partners

  • Comparative analysis with structurally characterized membrane proteins like Hyp730

While the specific function of Lin0773 remains to be fully characterized, its membrane localization suggests potential roles in:

  • Membrane integrity and maintenance

  • Transport of specific molecules across the bacterial membrane

  • Signal transduction or sensing environmental changes

  • Contributing to stress responses, similar to other bacterial membrane proteins that show differential expression under stress conditions

What experimental challenges are encountered when studying Lin0773 and how can they be overcome?

Membrane proteins like Lin0773 present several significant experimental challenges:

  • Expression and Purification Issues:

    • Membrane proteins often have low expression levels

    • They may form inclusion bodies when overexpressed

    • Their hydrophobic nature can lead to aggregation

    Solution approaches: Use specialized expression systems (e.g., C41/C43 E. coli strains), optimize induction conditions (lower temperature, reduced inducer concentration), and employ fusion partners that enhance solubility.

  • Structural Characterization Difficulties:

    • Crystallization of membrane proteins is notoriously challenging

    • Maintaining native conformation during purification requires careful detergent selection

    Solution approaches: Consider alternative structural biology techniques such as cryo-EM, NMR for specific domains, or computational modeling validated by biochemical experiments.

  • Functional Assays:

    • Difficulty in establishing in vitro assays when the function is unknown

    • Challenges in reconstituting membrane proteins into artificial membrane systems

    Solution approaches: Develop genetic approaches (gene deletion, complementation), use heterologous expression systems, or employ comparative studies with better-characterized homologs.

  • Data Interpretation:

    • High variability in experimental results due to the sensitive nature of membrane protein handling

    • Difficulty distinguishing specific from non-specific effects

    Solution approaches: Implement rigorous statistical analysis of experimental data, include appropriate controls, and validate findings using multiple independent methods .

What are the optimal conditions for expressing recombinant Lin0773 in bacterial systems?

Successful expression of Lin0773 requires careful optimization of several parameters:

ParameterRecommended ConditionsRationale
Expression HostE. coli BL21(DE3) or C41/C43C41/C43 strains are engineered for membrane protein expression
Growth Temperature16-25°CLower temperatures reduce inclusion body formation
Induction OD6000.6-0.8Mid-log phase provides balance between cell density and expression
Inducer Concentration0.1-0.5 mM IPTGLower concentrations often improve membrane protein solubility
Growth MediumTB or 2xYT with supplementsRich media support membrane protein production
Induction Duration12-18 hoursExtended expression at lower temperatures improves folding
Supplements0.5-1% glucose, 1 mM MgSO4Glucose reduces leaky expression; Mg2+ stabilizes membranes

When designing expression experiments, researchers should implement a factorial design approach to systematically test combinations of these parameters. Statistical analysis of expression yields will help identify optimal conditions . Additionally, fusion tags beyond the His-tag (such as MBP or SUMO) might improve solubility and should be considered as experimental variables.

What methods are recommended for functional characterization of Lin0773?

Given that Lin0773 is a membrane protein with uncharacterized function, a multi-faceted approach is recommended:

  • Comparative Genomics:

    • Analyze genomic context of lin0773 to identify potential operons or functionally related genes

    • Compare expression patterns with other genes under various conditions

  • Gene Deletion Studies:

    • Generate lin0773 knockout strains and assess phenotypic changes

    • Perform complementation studies to confirm specificity of observed effects

    • Test growth under various stress conditions (similar to approaches used for Hyp730)

  • Protein Interaction Studies:

    • Conduct pull-down assays with recombinant Lin0773 to identify binding partners

    • Perform bacterial two-hybrid screening

    • Use crosslinking approaches to capture transient interactions

  • Localization Studies:

    • Use fluorescently tagged Lin0773 to confirm membrane localization

    • Employ cell fractionation to determine precise subcellular localization

  • Transport Assays:

    • If transport function is suspected, perform liposome reconstitution with purified protein

    • Measure transport of potential substrates using fluorescent probes or radiolabeled compounds

Statistical analysis should be applied to all functional data following principles of good experimental design, including appropriate replication, randomization, and blinding where possible .

What are the most effective methods for structural characterization of Lin0773?

Structural characterization of membrane proteins like Lin0773 requires specialized approaches:

  • Secondary Structure Analysis:

    • Circular Dichroism (CD) spectroscopy to determine α-helical and β-sheet content

    • FTIR spectroscopy as a complementary method for secondary structure determination

    • Comparison with bioinformatic predictions of transmembrane domains

  • Tertiary Structure Investigations:

    • Tryptophan fluorescence to probe local environments of tryptophan residues

    • Limited proteolysis to identify folded domains resistant to digestion

    • Cross-linking studies to determine proximity of protein regions

  • High-Resolution Structure Determination:

    • Detergent screening for protein stability using techniques like thermal shift assays

    • Crystallization trials with selected detergents or lipidic cubic phase methods

    • Single-particle cryo-EM for larger membrane protein complexes

    • NMR studies of specific domains or fragments

  • Computational Approaches:

    • Homology modeling using related structures as templates

    • Molecular dynamics simulations to study behavior in membrane environments

    • Integration of experimental constraints with computational models

Similar approaches have been successfully applied to other membrane proteins like Hyp730 from M. luteus, where biophysical studies and CD spectroscopy validated in silico structure predictions of a double-pass membrane-spanning protein .

How should researchers analyze Lin0773 expression data for statistical significance?

When analyzing expression data for Lin0773, researchers should follow these statistical best practices:

Researchers should also consider advanced statistical approaches such as multivariate analysis when examining multiple parameters simultaneously, following established principles of statistical inference .

What are the best approaches for comparing Lin0773 with homologous proteins from other bacterial species?

Comparative analysis of Lin0773 with homologs requires systematic approaches:

  • Sequence-Based Comparisons:

    • Multiple sequence alignment of Lin0773 with homologs

    • Calculation of percent identity and similarity matrices

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Conservation analysis to identify highly conserved residues

  • Structure-Based Comparisons:

    • Comparative modeling based on available structures

    • Superposition of predicted structures to identify conserved structural elements

    • Analysis of electrostatic surface properties

    • Identification of conserved binding sites or functional pockets

  • Functional Comparison:

    • Cross-species complementation studies

    • Comparative expression analysis under similar conditions

    • Evaluation of genomic context across species

  • Statistical Analysis of Comparative Data:

    • Bootstrap analysis for phylogenetic trees to assess confidence

    • Calculation of dN/dS ratios to detect selection pressures

    • Statistical tests for evolutionary rate variation

    • Meta-analysis approaches when combining data from multiple studies

The high sequence similarity observed between Listeria species (e.g., 99.62% similarity between L. innocua and L. monocytogenes at the 16S rRNA level) suggests that careful statistical analysis will be necessary to identify subtle but potentially functionally important differences in membrane proteins like Lin0773 .

What considerations should be made when interpreting contradictory experimental results related to Lin0773?

When faced with contradictory results in Lin0773 research, consider these systematic approaches:

  • Methodological Differences:

    • Compare expression systems used (E. coli strains, vectors, growth conditions)

    • Examine purification protocols (detergents, buffer compositions)

    • Analyze protein handling conditions (storage, freeze-thaw cycles)

    • Evaluate assay conditions (temperature, pH, salt concentration)

  • Statistical Considerations:

    • Assess statistical power of contradictory studies

    • Examine sample sizes and replication strategies

    • Consider whether appropriate statistical tests were applied

    • Evaluate presence of outliers or data exclusion criteria

  • Biological Factors:

    • Consider strain-specific variations in the lin0773 gene

    • Evaluate potential post-translational modifications

    • Assess protein-protein interactions that might vary between experimental systems

    • Examine potential differences in membrane composition between systems

  • Resolution Strategies:

    • Design experiments specifically to address contradictions

    • Implement multiple complementary methods to test the same hypothesis

    • Collaborate with groups reporting contradictory results

    • Consider meta-analysis approaches to integrate disparate data

  • Reporting Recommendations:

    • Clearly document all experimental conditions

    • Make raw data available when possible

    • Provide detailed protocols to enhance reproducibility

    • Discuss limitations and potential sources of variability

What are the most promising future research directions for Lin0773?

Based on current knowledge, several promising research directions emerge:

  • Functional Characterization:

    • Systematic phenotypic analysis of lin0773 deletion mutants under various stress conditions

    • Identification of interaction partners through proteomics approaches

    • Investigation of potential role in dormancy or stress response, similar to other membrane proteins like Hyp730

  • Structural Biology:

    • High-resolution structure determination using advanced techniques

    • Structure-function relationship studies through mutagenesis of conserved residues

    • Membrane dynamics studies using advanced biophysical methods

  • Comparative Biology:

    • Expanded phylogenetic analysis across more bacterial species

    • Investigation of Lin0773 homologs in pathogenic vs. non-pathogenic Listeria species

    • Exploration of potential role in species-specific adaptations

  • Biotechnological Applications:

    • Assessment of Lin0773 as a potential drug target or biomarker

    • Exploration of recombinant Lin0773 as a tool for Listeria detection

    • Development of Lin0773-based systems for protein engineering studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.