Recombinant Listeria innocua serovar 6a UPF0344 protein lin2366 (lin2366)

What is Listeria innocua serovar 6a UPF0344 protein lin2366 and how is it characterized?

Listeria innocua serovar 6a UPF0344 protein lin2366 is an uncharacterized protein from the non-pathogenic bacterial species Listeria innocua, specifically from strain CLIP 11262. The protein belongs to the UPF0344 protein family, a designation for uncharacterized protein families with unknown function. The lin2366 gene encodes a 120-amino acid protein with a predicted transmembrane domain structure .

Characterization approaches for this protein typically include:

• Sequence alignment with homologous proteins

• Transmembrane domain prediction using bioinformatics tools

• Protein structure prediction using computational methods

• Functional assays based on genomic context analysis

The amino acid sequence of lin2366 is:
MWGYVHLISWVAIVVLTVTALLIYSKSKVKGFTMLQMINRFYILVILSGIMMVQYSVKESWILAILKILMGIIVIGVVEMLLSYRKQQKPTGMFLMIFIIVVVITVSLGFYLSGGYPLFN

This protein is typically characterized as having a molecular weight of approximately 13.4 kDa and contains hydrophobic regions consistent with membrane association.

How does Listeria innocua compare genetically to pathogenic Listeria species?

Listeria innocua and Listeria monocytogenes share significant genomic similarity, which enables potential gene transfer between these species. Key comparative characteristics include:

• Both species often occupy the same ecological niches, facilitating horizontal gene transfer

• L. innocua lacks the Listeria Pathogenicity Island 1 (LIPI-1) genes present in L. monocytogenes, which contributes to its non-pathogenic nature

• Despite lacking LIPI-1, L. innocua can carry multiple virulence genes involved in adhesion, invasion, surface protein anchoring, peptidoglycan modification, and intracellular survival

A detailed genomic analysis revealed that L. innocua isolates carry 13 virulence genes involved in various functions:

• Adhesion (fbpA, lap)

• Invasion (iap/cwhA, gtcA, lpeA)

• Surface protein anchoring (lspA)

• Peptidoglycan modification (oatA, pdgA)

• Intracellular survival (lplA1, prsA2)

• Heat stress response (clpC, clpE, clpP)

This genetic similarity makes L. innocua an important model organism for studying gene transfer mechanisms and potential virulence factor acquisition in Listeria species.

What expression systems are suitable for recombinant lin2366 production?

Multiple expression systems have been validated for recombinant lin2366 production, each with specific advantages depending on research objectives:

For lin2366, E. coli expression systems have been successfully utilized, with protein purity typically greater than 85% as determined by SDS-PAGE . The choice of expression system should be guided by the specific research application, with consideration for required protein modifications, folding requirements, and downstream applications.

What purification methods are recommended for recombinant lin2366?

Purification of recombinant lin2366 requires consideration of its membrane-associated properties. Recommended methodologies include:

• Initial Preparation:

  • Centrifugation of expression culture

  • Cell lysis via sonication or mechanical disruption

  • Membrane fraction isolation through differential centrifugation

• Purification Strategy:

  • Affinity chromatography using the appropriate tag (His-tag, Avi-tag)

  • For biotinylated Avi-tagged protein, BirA technology can be employed for in vivo biotinylation

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography as a polishing step

• Final Processing:

  • Lyophilization for long-term storage

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for storage at -20°C/-80°C

Quality control should include SDS-PAGE analysis with a minimum purity threshold of 85% . For transmembrane proteins like lin2366, detergent screening may be necessary to maintain protein solubility throughout the purification process.

What storage conditions maintain the stability of recombinant lin2366?

Proper storage of recombinant lin2366 is crucial for maintaining its structural integrity and functional properties. Recommended storage protocols include:

• Store lyophilized protein at -20°C upon receipt

• For reconstituted protein, aliquot to avoid repeated freeze-thaw cycles

• Add 5-50% glycerol (final concentration) to prevent freeze damage

• For long-term storage, maintain at -80°C

• Avoid repeated freeze-thaw cycles which can lead to protein degradation

Shelf life is dependent on multiple factors including storage temperature, buffer composition, and presence of stabilizing agents. Validation of protein integrity after storage periods is recommended through techniques such as SDS-PAGE and activity assays appropriate to the research application.

What experimental design considerations are important when studying lin2366 function?

Studying an uncharacterized protein like lin2366 requires a robust experimental design approach. Key considerations include:

• Factorial Design Approach:

  • Implement a full factorial design of experiments (DoE) methodology to systematically evaluate multiple variables affecting protein function

  • Include factors such as temperature, pH, ionic strength, and potential binding partners

  • Consider using a 3-way crossover design similar to those employed in protein requirement studies

• Control Selection:

  • Include positive controls (known functional proteins from the same family)

  • Include negative controls (denatured protein, buffer-only conditions)

  • Consider using a closely related UPF0344 protein from another Listeria species as a comparative control

• Variable Optimization:

  • Test environmental factors at multiple levels (e.g., temperature ranges from 10-40°C as used in similar studies)

  • Consider cellular context factors that might influence membrane protein function

  • Include replicates to ensure statistical power (minimum triplicate measurements)

• Data Analysis:

  • Employ statistical methods such as ANOVA to determine significant effects

  • Consider using indicator amino acid oxidation (IAAO) techniques for functional analysis

  • Implement specialized data analysis tools like those described in protein characterization studies

When planning experiments, remember that "At the heart of every Data Science project exists the planning, design and execution of experiments. Such experiments aim at understanding the data, potentially cleaning it and performing the necessary data analysis for knowledge discovery and decision-making" .

How can whole-genome sequencing be applied to study lin2366 in the context of Listeria innocua?

Whole-genome sequencing (WGS) provides powerful insights into the genomic context and potential function of lin2366. Methodological approaches include:

• Sequencing Strategy:

  • Employ next-generation sequencing platforms (Illumina, PacBio, or Oxford Nanopore)

  • Aim for high coverage (>30x) to ensure accurate assembly

  • Consider long-read sequencing to resolve repetitive regions and plasmids

• Bioinformatic Analysis Pipeline:

  • Assembly using tools like SPAdes or Unicycler

  • Gene prediction and annotation using Prokka or RAST

  • Specific analysis of lin2366 genomic context

  • Comparative genomics with other Listeria species

  • Screen for antimicrobial resistance genes using ResFinder

  • Identify virulence genes using VFDB

  • Detect plasmid replicons using PlasmidFinder

• lin2366 Specific Analysis:

  • Examine upstream and downstream regulatory elements

  • Identify potential operons containing lin2366

  • Look for conserved domains and motifs within the protein sequence

  • Conduct single nucleotide polymorphism (SNP) analysis to identify strain variations

• Functional Inference:

  • Use multilocus sequence typing (MLST) to determine the sequence type

  • Perform phylogenetic analysis to understand evolutionary relationships

  • Apply SNP-based phylogenetic analysis to reveal differences between isolates

In a recent study using this approach, "phylogenetic analysis revealed 422–1,091 SNP differences between our isolates and global lineages of L. innocua" , demonstrating the power of WGS for detailed characterization.

What methods can be used to assess potential virulence factors associated with lin2366?

While Listeria innocua is generally considered non-pathogenic, understanding potential virulence factors is crucial for comprehensive characterization:

• Genomic Screening Approaches:

  • Screen whole genome sequences against virulence factor databases (VFDB)

  • Use ABRicate tool with minimum 80% identity and coverage thresholds

  • Perform comparative genomics with pathogenic Listeria species

• Functional Assays:

  • Cell invasion assays using epithelial cell lines

  • Intracellular survival assays in macrophage models

  • Adhesion assays to evaluate binding to host cell components

  • Heat stress response assays to evaluate clpL gene function

• Protein-Protein Interaction Studies:

  • Co-immunoprecipitation to identify binding partners

  • Yeast two-hybrid screening

  • Proximity labeling in bacterial systems

  • Protein cross-linking followed by mass spectrometry

• Animal Models:

  • Mouse infection models to assess pathogenicity

  • Compare wild-type and lin2366 knockout strains

  • Evaluate immune responses to recombinant lin2366

Recent studies have shown that L. innocua isolates carry multiple virulence genes despite lacking the Listeria Pathogenicity Island 1, suggesting potential for virulence factor acquisition through horizontal gene transfer . Specifically, researchers should investigate the relationship between lin2366 and the heat resistance conferred by clpL genes found on plasmids in L. innocua .

How does the presence of plasmids affect lin2366 function and expression?

Plasmids play a significant role in bacterial adaptation and gene transfer, including potential effects on lin2366:

• Plasmid Analysis Methods:

  • Plasmid isolation and characterization using alkaline lysis

  • In silico analysis using Plasmid SPAdes and PLACNETw tools

  • Plasmid reconstructions and comparison using BLAST Ring Image Generator (BRIG)

  • Screening for plasmid replicons using PlasmidFinder

• Functional Relationships:

  • Investigate potential co-localization of lin2366 with plasmid-borne genes

  • Examine expression changes in the presence of different plasmids

  • Study horizontal transfer of plasmids between Listeria species

• Specific Plasmid Considerations:

  • L. innocua isolates often possess rep25 type plasmids

  • These plasmids may carry genes like clpL that mediate heat resistance

  • High sequence similarity (approximately 99%) exists between plasmids from L. innocua and L. monocytogenes

• Experimental Approaches:

  • Plasmid curing experiments to evaluate phenotypic changes

  • Complementation studies using cloned lin2366

  • Reporter gene fusions to study expression regulation

Research has shown that "The five isolates possessed an ATP-dependent protease (clpL) gene, which mediates heat resistance, on a rep25 type plasmids" , suggesting important functional relationships between plasmid-borne genes and cellular physiology that may impact lin2366 function.

What structural analysis methods should be applied to characterize UPF0344 family proteins?

Comprehensive structural characterization of UPF0344 family proteins like lin2366 requires a multi-technique approach:

• Computational Structure Prediction:

  • Homology modeling using related protein structures

  • Ab initio modeling for novel structural elements

  • Molecular dynamics simulations to predict conformational changes

  • Transmembrane domain prediction using specialized algorithms

• Experimental Structure Determination:

  • X-ray crystallography (challenging for membrane proteins)

  • Nuclear Magnetic Resonance (NMR) for structure determination

  • Cryo-electron microscopy for membrane protein complexes

  • Circular dichroism spectroscopy for secondary structure analysis

• Functional Structure Analysis:

  • Site-directed mutagenesis of predicted functional residues

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Crosslinking studies to identify intramolecular contacts

  • Fluorescence spectroscopy to monitor conformational changes

• Membrane Integration Studies:

  • Proteoliposome reconstitution

  • Nanodiscs for membrane protein stabilization

  • Detergent screening for optimal solubilization

  • Topology mapping using accessibility labeling

For transmembrane proteins like lin2366, specialized methods such as the MNP platform that "extracts high-purity nanoscale cell membrane particles while maintaining the conformation and activity of membrane proteins" may be particularly valuable for structural studies.

How can CRISPR-Cas9 genome editing be used to study lin2366 function?

CRISPR-Cas9 technology provides powerful tools for functional genomics studies of lin2366:

• Gene Knockout Strategies:

  • Design guide RNAs targeting lin2366

  • Create clean deletions using homology-directed repair

  • Generate knockout strains to evaluate phenotypic effects

  • Implement controls with non-targeting gRNAs

• Gene Modification Approaches:

  • Create point mutations in functional domains

  • Generate epitope-tagged versions for localization studies

  • Engineer promoter replacements to modulate expression

  • Introduce fluorescent protein fusions for live imaging

• Experimental Design Considerations:

  • Plan complementation studies to confirm specificity

  • Include phenotypic assays relevant to predicted function

  • Consider essential gene status and design conditional knockouts if necessary

  • Validate edits through sequencing and expression analysis

• Advanced Applications:

  • CRISPRi for tunable gene repression

  • CRISPRa for targeted gene activation

  • Multiplexed editing to study genetic interactions

  • Prime editing for precise sequence modifications

When designing CRISPR experiments, consider implementing a "comprehensive full factorial Design of Experiment methodology" to systematically evaluate the effects of lin2366 modification across different genetic backgrounds and environmental conditions.

What are the protein requirements for optimal recombinant lin2366 expression and folding?

Determining optimal protein requirements for recombinant lin2366 expression requires systematic investigation:

• Expression Optimization:

  • Systematically vary protein concentration in expression media

  • Test different amino acid supplementation strategies

  • Evaluate expression at varying temperatures (15-37°C)

  • Optimize induction conditions (timing, inducer concentration)

• Methodological Approach:

  • Use the indicator amino acid oxidation (IAAO) technique to determine optimal protein requirements

  • Implement a multi-level experimental design with different protein intakes

  • Use labeled amino acids (e.g., l-[1-¹³C]-lysine) as indicators of protein synthesis

  • Measure ¹³CO₂ production as a primary indicator of protein synthesis

• Data Analysis:

  • Identify breakpoints in protein synthesis efficiency

  • Calculate the estimated average requirement (EAR) for protein

  • Determine the bioavailability of different protein sources

  • Compare efficiency across different expression systems

• Folding Considerations:

  • Test chaperone co-expression strategies

  • Evaluate folding in different detergent environments

  • Optimize redox conditions for proper disulfide formation

  • Consider slow temperature ramping for improved folding

Research on protein requirements has shown that "current protein recommendations may be underestimated" , suggesting that optimizing protein conditions could significantly improve recombinant protein expression and folding efficiency.

How can researchers distinguish between Listeria innocua and other Listeria species when working with lin2366?

Accurate species identification is crucial when working with Listeria strains:

• Molecular Identification Methods:

  • PCR-RFLP analysis of specific genes

  • Multiplex PCR targeting the iap gene

  • Whole genome sequencing followed by comparative genomics

  • MALDI-TOF MS for rapid species identification

• Biochemical Differentiation:

  • API Listeria system for biochemical profiling

  • Hemolysis testing (L. innocua is non-hemolytic)

  • Carbohydrate utilization patterns

  • Phosphatidylinositol-specific phospholipase C activity

• lin2366-Specific Identification:

  • Design PCR primers specific to the lin2366 gene of L. innocua

  • Develop antibodies against unique epitopes of the lin2366 protein

  • Use sequence analysis to distinguish from homologs in other species

• Challenges and Solutions:

  • Address potential misidentification between L. innocua and L. monocytogenes

  • Implement multiple identification methods when results conflict

  • Consider that some isolates may show superimposed patterns in PCR-RFLP analysis

  • Use targeted sequencing when conventional methods give ambiguous results

Research has shown that "When biochemical and molecular methods gave conflicting data (29 strains), a third method, multiplex PCR of the iap gene, was performed" , highlighting the importance of using multiple identification approaches for accurate species determination.