Recombinant Listeria innocua serovar 6a UPF0756 membrane protein lin1603 (lin1603)

What is the basic structural composition of recombinant lin1603 protein?

The recombinant lin1603 protein is a full-length (153 amino acids) UPF0756 membrane protein from Listeria innocua serovar 6a. The amino acid sequence is: MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHVDGKAMELIQAKGINWGVTIIT VAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVDPQVTVSLVFG TILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK. It is typically expressed as a recombinant protein in E. coli with an N-terminal His-tag, which facilitates purification and detection in experimental systems .

What are the optimal storage conditions for maintaining lin1603 protein stability?

For optimal stability, the recombinant lin1603 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 or in a Tris-based buffer with 50% glycerol optimized for this specific protein . Repeated freezing and thawing significantly compromises protein integrity and should be avoided to maintain consistent experimental results.

How should the lyophilized lin1603 protein be reconstituted for experimental use?

For reconstitution of lyophilized lin1603 protein, first centrifuge the vial briefly to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot before storing at -20°C/-80°C . This reconstitution method preserves the structural integrity and biological activity of the protein for subsequent experimental applications.

How can lin1603 protein be used as a model system for membrane protein studies?

Lin1603 serves as an excellent model system for membrane protein research due to its stable expression in E. coli and well-characterized structure. To utilize this protein in membrane studies, researchers should:

• Express the His-tagged protein in E. coli using standard recombinant protein expression systems

• Purify using nickel affinity chromatography

• Incorporate the purified protein into lipid bilayers or detergent micelles for structural and functional studies

• Use biophysical techniques such as circular dichroism (CD) spectroscopy or differential scanning calorimetry (DSC) to analyze membrane insertion and stability

This approach provides insights into membrane protein folding, insertion mechanisms, and structural dynamics that can be extrapolated to more complex membrane protein systems .

What are the comparative analytical methods for studying lin1603 versus virulence-associated membrane proteins?

When comparing lin1603 with virulence-associated membrane proteins from pathogenic Listeria species, researchers should implement a multi-faceted analytical approach:

This comparative approach helps identify structural and functional differences between non-pathogenic lin1603 and virulence factors in pathogenic species, potentially revealing therapeutic targets .

How does L. innocua serovar 6a differ from pathogenic Listeria species at the molecular level?

L. innocua serovar 6a differs from pathogenic Listeria species, particularly L. monocytogenes, in several key molecular aspects. In silico analysis comparing surface protein repertoires revealed that certain genes encoding surface proteins in L. monocytogenes are absent in L. innocua, including the aut gene which encodes Auto, a protein with autolytic activity critical for virulence. Auto contains 572 amino acids with a signal sequence, an N-terminal autolysin domain, and a C-terminal cell wall-anchoring domain comprising four GW modules . This protein is required for entry of L. monocytogenes into non-phagocytic eukaryotic cells and contributes to virulence in animal models. The absence of such proteins in L. innocua explains its non-pathogenic nature and makes it suitable for comparative studies investigating virulence mechanisms.

What methodologies can be used to investigate heat resistance properties of L. innocua compared to L. monocytogenes?

To investigate heat resistance properties of L. innocua compared to L. monocytogenes, researchers should employ the following methodological approach:

• Prepare standardized cultures of both L. innocua (such as ATCC 33091 or PFEI strain) and L. monocytogenes (F5069 and Scott A strains)

• Subject cultures to thermal treatments in controlled heating menstrua (e.g., phosphate buffer or milk) at temperatures ranging from 56-66°C

• Calculate decimal reduction times (D-values) for each strain at various temperatures

• Construct thermal death curves to compare resistance profiles

• Apply mathematical models to quantify differences in thermal resistance

Studies have demonstrated that L. innocua strains exhibit 1.5-3 times longer D-values compared to the most heat-resistant L. monocytogenes strains, making them valuable surrogate organisms for thermal process validation studies .

What genomic approaches can be used to identify functional homologs of lin1603 in other bacterial species?

To identify functional homologs of lin1603 in other bacterial species, researchers should implement a comprehensive genomic approach:

• Sequence similarity searches: Use BLAST algorithms (BLASTp, PSI-BLAST) with the lin1603 protein sequence against comprehensive protein databases

• Domain architecture analysis: Identify conserved UPF0756 domains across diverse bacterial proteomes using InterProScan or HMMER

• Synteny analysis: Examine gene neighborhood conservation using tools like SyntTax or MicrobesOnline

• Phylogenetic profiling: Construct phylogenetic trees of putative homologs to establish evolutionary relationships

• Structural prediction comparison: Use AlphaFold or similar tools to predict and compare tertiary structures of potential homologs

• Functional validation: Express and characterize candidate homologs to confirm similar biochemical properties

This multi-faceted approach helps identify both close and distant functional homologs that may share biological roles despite sequence divergence .

How can radiation resistance models developed with L. innocua be applied to food safety research?

Radiation resistance models developed with L. innocua can be systematically applied to food safety research through the following methodological framework:

• Inoculate food matrices (e.g., raw milk) with standardized L. innocua cultures (ATCC 33091)

• Apply gamma irradiation at graduated doses (0.5-3 kGy)

• Determine microbial reduction at each dose level

• Fit mathematical models to inactivation data using specialized software (e.g., GinaFIT)

• Calculate kinetic indices including:

  • Decimal reduction values (D-values)

  • Predicted doses for 4-log reduction

  • Shoulder and tail parameters for non-linear models

For L. innocua, the log-linear + shoulder model typically provides the best fit, with approximately 6 logarithmic cycles reduction observed at 3 kGy. The predicted dose for 4D reduction is approximately 2.22 kGy, higher than the 1.77 kGy required for E. coli, indicating greater radiation resistance . These models allow for accurate prediction of microbial inactivation in real food systems and development of scientifically validated food safety protocols.

What are the optimal PCR conditions for amplifying the lin1603 gene from L. innocua genomic DNA?

For optimal PCR amplification of the lin1603 gene from L. innocua genomic DNA, researchers should implement the following protocol:

• Template preparation: Extract high-quality genomic DNA from L. innocua strain SLCC 3423 (ATCC 33091) using standard bacterial DNA isolation methods

• Primer design:

  • Forward primer targeting 5' region with added restriction site for subsequent cloning

  • Reverse primer incorporating the 3' end with appropriate tag sequence if needed

  • Optimal primer length: 20-25 nucleotides with 40-60% GC content

• PCR reaction components:

  • High-fidelity DNA polymerase (e.g., Phusion or Q5)

  • Optimized buffer system with appropriate Mg²⁺ concentration

  • dNTPs at 200 μM each

  • Primers at 0.5 μM each

  • 10-50 ng of genomic DNA template

• Thermal cycling conditions:

  • Initial denaturation: 98°C for 30 seconds

  • 30 cycles of:

    • Denaturation: 98°C for 10 seconds

    • Annealing: 58-62°C for 20 seconds (optimize based on primer Tm)

    • Extension: 72°C for 30 seconds (15-30 seconds/kb)

  • Final extension: 72°C for 5 minutes

• Product verification: Analyze PCR products by agarose gel electrophoresis to confirm amplification of the expected 459 bp fragment

The genomic DNA provided by ATCC (catalog number 33091D-5) is specifically prepared for PCR applications and ensures reliable amplification results .

What are the most effective methods for site-directed mutagenesis of the lin1603 gene to study structure-function relationships?

To perform effective site-directed mutagenesis of the lin1603 gene for structure-function studies, researchers should follow this comprehensive methodology:

• Mutation site selection:

  • Target conserved residues identified through sequence alignment with homologous proteins

  • Focus on predicted functional domains within the membrane topology

  • Consider charged residues that may participate in protein-protein interactions

• Mutagenesis techniques:

  • QuikChange method: Use complementary primers containing the desired mutation

  • Overlap extension PCR: Generate two fragments with overlapping mutated regions

  • Gibson Assembly: Design primers with mutation and overlapping sequences for seamless assembly

• Validation approach:

  • Sequence verification of mutants

  • Expression testing in E. coli system

  • Purification using standard His-tag affinity methods

• Functional characterization:

  • Membrane localization assays

  • Protein stability assessments

  • Interaction studies with potential binding partners

  • Structural analysis through CD spectroscopy or limited proteolysis

This systematic approach allows for comprehensive analysis of how specific amino acid residues contribute to the protein's structure, membrane integration, and potential functional roles .

How can advanced structural biology techniques be applied to determine the membrane topology of lin1603?

To determine the membrane topology of lin1603, researchers should employ a multi-technique structural biology approach:

By integrating computational predictions with experimental validation, researchers can generate a comprehensive topological map of lin1603, identifying which segments traverse the membrane, which regions face the cytoplasm, and which are exposed to the periplasm or extracellular environment .

What proteomics approaches can identify interaction partners of lin1603 in membrane protein complexes?

To identify interaction partners of lin1603 in membrane protein complexes, researchers should implement the following proteomics workflow:

• Affinity purification strategies:

  • Express His-tagged lin1603 in L. innocua or heterologous systems

  • Perform crosslinking to stabilize transient interactions (use DSP, formaldehyde, or photo-activatable crosslinkers)

  • Conduct pull-down assays using Ni-NTA or anti-His antibodies

  • Include proper controls with untagged proteins or irrelevant His-tagged proteins

• Mass spectrometry analysis:

  • Employ nano-LC-MS/MS for peptide separation and identification

  • Implement label-free quantification to distinguish specific from non-specific interactors

  • Consider SILAC or TMT labeling for quantitative comparison across conditions

• Proximity labeling approaches:

  • Create BioID or APEX2 fusions with lin1603

  • Express in native or heterologous systems

  • Identify proteins in spatial proximity through biotinylation and streptavidin purification

• Validation methods:

  • Bacterial two-hybrid assays for direct interaction testing

  • Co-immunoprecipitation with specific antibodies

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction validation

This comprehensive proteomics approach allows for the identification of both stable and transient interactors of lin1603, providing insights into its potential roles in membrane protein complexes and cellular functions .