Recombinant Listeria monocytogenes serovar 1/2a Actin assembly-inducing protein (actA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
actA; prtB; lmo0204; Actin assembly-inducing protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-639
Protein Length
Full Length of Mature Protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
actA
Target Protein Sequence
ATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADL IAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRR KAIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQ PFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPP TDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTDEELRLALPETPMLLGFNAPATSE PSSFEFPPPPTEDELEIIRETASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEEL NGRGGRPTSEEFSSLNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNAGFLPLNPFA SSPVPSLSPKVSKISAPALISDITKKTPFKNPSQPLNVFNKKTTTKTVTKKPTPVKTAPK LAELPATKPQETVLRENKTPFIEKQAETNKQSINMPSLPVIQKEATESDKEEMKPQTEEK MVEESESANNANGKNRSAGIEEGKLIAKSAEDEKAKEEPGNHTTLILAMLAIGVFSLGAF IKIIQLRKNN
Uniprot No.

Target Background

Function
ActA, a virulence factor, is crucial for interaction with host cell microfilaments. It induces actin assembly around the bacteria, facilitating intracellular movement and playing a key role in actin polymerization. Its function appears to be as a nucleator, triggering reorganization of the actin cytoskeleton.
Gene References Into Functions
  1. ActA plays a critical role in Listeria virulence; its absence renders bacteria intracellularly immotile and largely non-infectious. [Review] PMID: 27726006
  2. Cell wall proteomics of intracellular Listeria monocytogenes reveals ActA's association with peptidoglycan. PMID: 21846725
  3. ActA-mediated cell-to-cell spread is pivotal in the vertical transmission of L. monocytogenes to the fetus in murine models. PMID: 17118980
Database Links

KEGG: lmo:lmo0204

STRING: 169963.lmo0204

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ActA protein and what experimental approaches best characterize its functions?

ActA is an integral membrane protein and a major virulence determinant of Listeria monocytogenes (Lm). Its primary function is enabling actin polymerization, which promotes intracellular motility and cell-to-cell spread of the bacteria . ActA facilitates the production of actin tails that propel Listeria throughout the cytosol of infected host cells, allowing it to evade host cell defenses and facilitating invasion into adjacent uninfected cells .

To properly characterize ActA functions, researchers should employ multiple experimental approaches:

  • Genetic manipulation: Generate ActA deletion mutants (ΔactA) and compare their phenotypes with wild-type strains .

  • Fluorescence microscopy: Visualize actin tail formation using fluorescently labeled actin.

  • Transcriptional reporter systems: Use lacZ and cat gene fusions to monitor actA expression in different environments .

  • Protein interaction studies: Investigate ActA-ActA interactions using biochemical approaches .

  • Animal models: Employ germfree mice for gut colonization studies, as Lm poorly colonizes conventional mouse gut .

ActA FunctionExperimental ApproachKey Findings
Actin polymerizationFluorescence microscopy with ΔactA mutantsActA is essential for actin tail formation and intracellular motility
Bacterial aggregationIn vitro aggregation assaysActA C-terminal region mediates direct ActA-ActA interactions
Biofilm formationCrystal violet assays with wild-type and ΔactA strainsActA is critical for biofilm development
Gut colonizationGF mouse models with oral infectionActA-dependent aggregating bacteria persist longer in gut lumen
ImmunomodulationTumor immunotherapy modelsActA can function as an adjuvant

How is ActA expression regulated during different stages of infection?

ActA expression is differentially regulated in response to the growth environment and infection stage. Methodological approaches to study this regulation include:

  • Transcriptional fusion assays: The actA gene shows different expression patterns in broth cultures versus intracellular environments.

  • Quantitative PCR: Measure actA transcript levels under various conditions.

  • Protein quantification: Western blotting and immunoprecipitation to measure ActA protein levels.

Research data demonstrates:

  • Broth vs. intracellular expression: ActA is preferentially expressed during intracellular growth. The actA promoter activity is approximately 3-fold higher than the hly (listeriolysin O) promoter in J774 cell cytosol, while it shows 10-fold lower expression than hly in LB broth .

  • Induction levels: Compared to broth cultures, actA is highly induced (226-fold) during intracellular growth, while hly is moderately induced (20-fold) in J774 cells .

  • Protein abundance: Quantitative immunoprecipitation shows approximately 70-fold more cytosolic ActA than LLO in infected cells, suggesting additional post-transcriptional regulation mechanisms .

  • PrfA regulation: ActA is described as a PrfA-regulated gene product, indicating that the transcriptional activator PrfA controls ActA expression .

These findings highlight the importance of studying ActA expression in physiologically relevant contexts rather than relying solely on in vitro models.

What structural domains of ActA contribute to its various functions?

ActA contains distinct structural domains that contribute to its multifaceted functions. Experimental approaches to delineate these domains include:

  • Deletion mutant analysis: Generate constructs with specific domain deletions to assess functional impacts.

  • Recombinant protein expression: Express individual domains to test specific functions.

  • Protein interaction studies: Identify binding partners for different domains.

Based on research findings:

  • N-terminal region: This region is involved in actin polymerization and is essential for intracellular motility. It contains binding sites for host cell proteins involved in actin nucleation .

  • Central region: Contains proline-rich repeats that interact with host cell proteins involved in actin assembly.

  • C-terminal region: This region is not involved in actin polymerization but is essential for bacterial aggregation in vitro through direct ActA-ActA interactions . This domain is critical for biofilm formation and intestinal colonization.

  • Membrane anchor: As an integral membrane protein, ActA's membrane-anchoring domain ensures proper localization on the bacterial surface .

Western blot analyses have identified ActA-reactive antigens with molecular masses of approximately 96, 60, 40, and 14 kDa, likely representing different forms or degradation products of the protein .

Understanding these domain-specific functions is crucial for designing targeted experimental approaches and potential therapeutic interventions.

How do ActA-ActA interactions facilitate bacterial aggregation and biofilm formation?

ActA mediates Listeria monocytogenes aggregation through direct protein-protein interactions. To study this phenomenon, researchers should consider:

  • In vitro aggregation assays: Compare wild-type and mutant strains lacking specific ActA domains.

  • Fluorescence microscopy: Visualize bacterial aggregates using fluorescently labeled bacteria.

  • Biofilm quantification: Use crystal violet staining to assess biofilm formation.

  • Atomic force microscopy: Measure the strength of ActA-ActA interactions.

Research data indicates:

  • Direct interactions: ActA proteins on the surface of different bacterial cells interact directly with each other, leading to bacterial aggregation. This interaction is independent of ActA's actin polymerization function .

  • Domain specificity: The C-terminal region of ActA, which is not involved in actin polymerization, is essential for aggregation in vitro . This suggests a domain-specific function within the ActA protein.

  • Functional consequences: In mice permissive to orally-acquired listeriosis, ActA-dependent aggregating bacteria show an increased ability to persist within the cecum and colon lumen. These aggregating bacteria are shed in the feces three orders of magnitude more efficiently and for twice as long as bacteria unable to aggregate .

  • Environmental relevance: ActA-mediated aggregation is critical for biofilm formation, which enhances environmental survival and colonization of various substrates .

This aggregation mechanism represents a previously underappreciated role of ActA beyond its well-established function in intracellular motility and cell-to-cell spread.

What methods are most effective for studying ActA-negative mutants in gut colonization models?

ActA-negative mutants (ΔactA) provide valuable tools for studying gut colonization and immune responses. Methodological approaches include:

  • Germfree mouse models: Since L. monocytogenes poorly colonizes conventional mouse gut, researchers use germfree mice for studying colonization dynamics .

  • Oral infection protocols: Administer defined doses of ΔactA mutants orally and monitor:

    • Bacterial burden in intestinal tissues over time

    • Bacterial shedding in feces

    • Development of mucosal and systemic immune responses

  • Immune response assessment techniques:

    • Fragment culture assays: Culture intestinal segments and analyze supernatants for total and listeria-specific IgA .

    • ELISPOT assays: Quantify total IgA and listeria-specific IgA-secreting cells in lamina propria .

    • Western blot analysis: Identify reactive antigens using intestinal fragment culture supernatants .

Time After InfectionTotal IgAListeria-specific IgAAntibody-Secreting Cells
Day 7Pronounced increaseMinimalNot assessed
Day 14ElevatedModest levelsNot assessed
Day 21ElevatedIncreasingDetected in lamina propria
Day 28ElevatedIncreasing~2x higher than day 21
Day 76ElevatedPeakedNot assessed
Day 90MaintainedStabilizedNot assessed

This temporal analysis demonstrates that ΔactA mutants induce sustained mucosal immune responses despite limited systemic dissemination, making them excellent tools for studying compartmentalized gut immunity .

How does ActA expression differ between in vitro culture and intracellular environments?

Understanding the differential expression of ActA between laboratory cultures and physiological environments is critical for experimental design. Methods to assess this difference include:

  • Transcriptional reporter systems: Using actA promoter fusions to lacZ or cat genes to monitor expression in different conditions .

  • Protein quantification methods:

    • Western blotting with ActA-specific antibodies

    • Immunoprecipitation from infected cells versus broth cultures

    • Flow cytometry with fluorescently labeled antibodies

  • Single-cell analysis: Fluorescence microscopy to visualize ActA expression at the individual bacterium level.

Research findings demonstrate dramatic differences:

  • Transcriptional activation: The actA fusion showed minimal activation in LB broth but was highly active in J774 cell cytosol .

  • Induction magnitude: Compared to broth cultures, actA was induced 226-fold during intracellular growth, while hly (encoding listeriolysin O) was induced only 20-fold .

  • Relative expression patterns: In broth, hly expression was 10-fold higher than actA. Conversely, in J774 cytosol, actA fusion activity was 3-fold higher than hly fusion .

  • Protein abundance: Despite the 3-fold transcriptional difference, immunoprecipitation revealed approximately 70-fold more ActA than LLO in the cytosol of infected cells, suggesting significant post-transcriptional regulation .

This differential regulation highlights the importance of studying ActA in physiologically relevant contexts. Experiments designed to characterize ActA function should include both in vitro and intracellular conditions to capture the full spectrum of its behavior.

What is the potential of ActA as an adjuvant in tumor immunotherapy?

ActA shows significant promise as an adjuvant for tumor immunotherapy. To evaluate and harness this potential, researchers should employ:

  • Antigen fusion approaches: Engineer ActA-tumor antigen fusion proteins to enhance immunogenicity.

  • Delivery systems:

    • Direct protein administration

    • DNA vaccines encoding ActA-antigen fusions

    • Attenuated Listeria vectors expressing ActA-antigen constructs

  • Immune response assessment:

    • T cell activation assays (proliferation, cytokine production)

    • Antibody response quantification

    • In vivo tumor challenge models

Research findings demonstrate:

  • Adjuvant activity: ActA functions effectively as an adjuvant when either fused to a tumor antigen or administered as a mixture with a tumor antigen .

  • Immune response enhancement: ActA augments anti-tumor immune responses, breaks immune tolerance, and facilitates tumor eradication .

  • Versatile application: ActA is effective in both primary and secondary (booster) immunizations, suggesting broad applicability in vaccination protocols .

  • Mechanism considerations: Although ActA normally facilitates Listeria's evasion of host defenses, when properly harnessed, it enhances immune responses against tumor antigens .

These findings position ActA as a promising new class of adjuvants that could enhance cancer vaccine efficacy by promoting stronger anti-tumor immune responses. This represents a novel repurposing of a bacterial virulence factor for therapeutic benefit.

How can contradictory data about ActA expression be reconciled in experimental design?

Research on ActA expression has revealed apparent contradictions that require methodological consideration. To reconcile these discrepancies:

  • Implement integrated experimental approaches:

    • Combine transcriptional (reporter fusions) and protein-level (immunoprecipitation) analyses in parallel samples

    • Use multiple independent methods to verify key findings

    • Include appropriate controls for each condition tested

  • Consider temporal dynamics:

    • Design longitudinal studies with multiple time points

    • Specific immune responses show time-dependent changes (modest at day 14, increasing until day 76)

    • Single time-point analyses may miss critical dynamics

  • Address in vitro vs. in vivo discrepancies:

    • Include both conditions in experimental designs

    • The actA gene shows minimal activation in broth but high induction intracellularly

    • Be cautious about extrapolating in vitro findings to in vivo scenarios

  • Resolve transcriptional vs. post-transcriptional regulation:

    • actA transcription is 3-fold higher than hly in J774 cells, but ActA protein is 70-fold more abundant than LLO

    • Investigate mRNA stability, translation efficiency, and protein turnover rates

  • Account for functional duality:

    • ActA contributes to pathogenesis through actin-based motility

    • Yet functions as an effective adjuvant in immunotherapy

    • Design experiments that separate these functions using domain-specific constructs

What are the methodological challenges in producing recombinant ActA for research applications?

Producing functional recombinant ActA presents several technical challenges that researchers must address:

  • Expression system selection:

    • Bacterial systems: May lack appropriate post-translational modifications

    • Eukaryotic systems: May better recapitulate native ActA modifications

    • Cell-free systems: Allow rapid screening of conditions but may have lower yields

  • Structural considerations:

    • ActA is an integral membrane protein with distinct functional domains

    • Solubility issues often require creating truncated or modified versions

    • Fusion tags may affect protein folding and function

  • Functional validation approaches:

    • Actin polymerization assays: Verify N-terminal domain activity

    • Aggregation assays: Test C-terminal domain function

    • Immunological assays: Confirm adjuvant properties

    • Cell entry assays: Validate FcγRIa-binding capability

  • Purification strategies:

    • Detergent selection for membrane protein solubilization

    • Chromatography methods optimized for ActA's biophysical properties

    • Quality control to verify correct folding and domain function

  • Application-specific modifications:

    • For immunology studies: Engineer a "recombinant soluble form of ActA" to enter the MHC class I-processing compartment

    • For tumor immunotherapy: Create ActA-tumor antigen fusion constructs

    • For structural studies: Express individual domains separately

  • Domain-specific considerations:

    • The N-terminal domain mediates actin polymerization

    • The C-terminal domain is essential for aggregation

    • These domains may require different expression and purification conditions

Given these challenges, researchers should consider whether full-length ActA is necessary for their specific application or if domain-specific constructs would be more practical and provide cleaner experimental systems.

How does ActA promote FcγRIa-mediated entry of Listeria?

ActA's role in FcγRIa-mediated entry represents a novel function beyond its established roles in actin-based motility and bacterial aggregation. To investigate this mechanism:

  • Cell culture models:

    • Compare wild-type and ΔactA mutants for entry into FcγRIa-expressing cells

    • Use FcγRIa-negative cell lines as controls

    • Employ FcγRIa-blocking antibodies to confirm specificity

  • Protein interaction studies:

    • Direct binding assays between purified ActA and FcγRIa

    • Co-immunoprecipitation from infected cells

    • Surface plasmon resonance to determine binding kinetics

  • Structural biology approaches:

    • Identify the ActA domains involved in FcγRIa binding

    • Generate domain-specific mutants to map interaction sites

    • Computational modeling of the ActA-FcγRIa interface

Research findings demonstrate:

  • ActA requirement: ActA is necessary for FcγRIa-mediated entry of Listeria into host cells .

  • Sufficient for entry: ActA was found to be sufficient for the internalization process, suggesting its direct role as a bacterial ligand for FcγRIa .

  • Novel exploitation mechanism: This represents a unique way Listeria exploits host immune receptors to facilitate its entry, expanding our understanding of how the bacterium subverts host cellular signaling pathways .

This discovery highlights how Listeria has evolved multiple strategies to exploit host cellular machinery, using the same protein (ActA) for different aspects of its pathogenic lifecycle - intracellular motility, bacterial aggregation, and now receptor-mediated entry .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.