Recombinant Listeria monocytogenes serovar 1/2a Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls; lmo2503; Cardiolipin synthase; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
cls
Target Protein Sequence
MGLLAYLLVILLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDPNVKKHRDLIYLLLVNDGAILTQDNE VELFVDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFQKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDVGYIGGFNI GDEYLGASKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTHKIDYKARYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKQMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL
Uniprot No.

Target Background

Function

This enzyme catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: lmo:lmo2503

STRING: 169963.lmo2503

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase and what is its function in Listeria monocytogenes?

Cardiolipin synthase (cls) is an essential enzyme involved in the biosynthesis of cardiolipin, a unique phospholipid component of bacterial membranes. In Listeria monocytogenes, cardiolipin constitutes a significant portion of the membrane phospholipids and plays crucial roles in membrane stability, energy metabolism, and stress response. The enzyme catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol.

The cls gene in L. monocytogenes encodes this enzyme, which becomes particularly important during bacterial adaptation to environmental stresses such as osmotic shock, pH changes, and temperature fluctuations. These stress conditions are frequently encountered by L. monocytogenes during food processing and within host environments. The enzyme's activity directly impacts membrane fluidity and impermeability, which can influence bacterial survival in adverse conditions.

How does Listeria monocytogenes serovar 1/2a differ from other serovars?

Listeria monocytogenes serovar 1/2a represents one of the most prevalent strains associated with human listeriosis cases. It differs from other serovars in several key aspects:

Serovar 1/2a strains can be differentiated from others based on PCR and restriction enzyme analysis (REA) methods. Research has demonstrated that serovar 1/2a strains can be divided into two distinct groups based on restriction profiles. In one study examining 100 strains of L. monocytogenes serovar 1/2a isolated from various sources including humans, animals, food, and the environment, 70 strains shared one restriction profile while the remaining 30 shared a second profile .

Unlike serotype 4a strains, serovar 1/2a strains generally demonstrate enhanced virulence in human infections. They possess specific surface proteins, particularly internalin A (InlA) and internalin B (InlB), which facilitate host cell invasion. The genes encoding these proteins (inlA and inlB) have been studied extensively through PCR-REA methods, revealing a 2,916 bp segment containing the downstream end of inlA (955 bp), the space between inlA and inlB (85 bp), and 1,876 bp of inlB .

Serovar 1/2a strains are more frequently isolated from food products and processing environments compared to other serovars, contributing to their prominence in foodborne outbreaks.

What are the primary methods for expressing recombinant Listeria monocytogenes proteins?

Recombinant L. monocytogenes proteins, including Cardiolipin synthase, can be expressed using several expression systems, each with distinct advantages:

  • Bacterial expression systems: Escherichia coli remains the most common expression host for recombinant L. monocytogenes proteins due to its rapid growth, high expression yields, and well-established protocols. For example, recombinant L. monocytogenes proteins can be successfully expressed in E. coli expression systems with appropriate optimization of growth conditions and induction parameters .

  • Yeast expression systems: These provide eukaryotic post-translational modifications that may enhance protein functionality. Yeast systems can be particularly useful for L. monocytogenes proteins that require specific folding environments .

  • Baculovirus expression systems: When more complex folding or post-translational modifications are required, insect cell-based expression via baculovirus vectors offers advantages for producing functional L. monocytogenes proteins .

  • Mammalian cell expression systems: These provide the most sophisticated processing environment and are used when authentic mammalian post-translational modifications are critical for protein function or immunogenicity studies .

The choice of expression system depends on research objectives, protein characteristics, and downstream applications. Factors including protein solubility, functionality, and yield requirements should guide system selection.

How should researchers design infection models using recombinant L. monocytogenes to study host immune responses?

When designing infection models using recombinant L. monocytogenes to study host immune responses, researchers should consider several critical factors:

Sample size and controls: Experiments should be adequately powered with appropriate controls. Due to biological variation in immune responses, it is recommended to use at least 4-5 mice per group for initial immune studies. Uninfected controls should be included for baseline determination of IFN-γ responses, and vehicle controls help distinguish treatment effects from stress responses associated with administration .

Timing of treatment: Since innate responses to L. monocytogenes occur rapidly, treatments should be administered either on the day prior to or simultaneously with inoculation. This ensures therapeutic levels of reagents are achieved before the initiation of innate immune responses .

Pathogen dosage considerations: The choice of pathogen dose is crucial. A sublethal dose (below LD50) is recommended for measuring bacterial load and adaptive lymphocyte IFN-γ responses, as it increases the chance that bacteria will concentrate in the spleen and liver for more accurate enumeration. For studying early NK and NKT cell responses, a higher infectious dose may be used to maximize IFN-γ production .

Mouse strain selection: C57BL/6J mice are particularly suitable for measuring IFN-γ responses as they are Th1-prone and relatively resistant to L. monocytogenes infection compared to Th2-prone strains like BALB/c. Researchers should use mice of consistent age, sex, and vendor to reduce experimental variability .

The table below summarizes key parameters for L. monocytogenes infection models:

ParameterRecommendationRationale
Sample size4-5 mice per groupAccounts for biological variation in immune response
Pathogen dose for bacterial load studiesSublethal doseEnhances accuracy of bacterial enumeration
Pathogen dose for innate response (24h)Higher infectious doseMaximizes IFN-γ production by NK and NKT cells
Mouse strainC57BL/6JTh1-prone, relatively resistant to listeriosis
Modified LD50 (C57BL/6J, 8-week-old)105 CFU (male), 1.5 × 105 CFU (female)Determined using clinical endpoints rather than mortality

What purification strategies are most effective for isolating recombinant Cardiolipin synthase from L. monocytogenes?

Efficient purification of recombinant Cardiolipin synthase (cls) from L. monocytogenes requires a well-designed strategy that considers the protein's membrane-associated nature and enzymatic activity preservation. Based on research practices with similar recombinant L. monocytogenes proteins, the following approaches are recommended:

Affinity chromatography: Using poly-histidine (His) tags is the most common initial purification step. The recombinant cls protein can be engineered with an N-terminal or C-terminal His-tag, allowing purification via nickel or cobalt-based affinity resins. This approach typically yields 85-90% purity in a single step.

Detergent selection: Since cls is a membrane-associated enzyme, proper detergent selection is critical for solubilization while maintaining enzymatic activity. A comparison of commonly used detergents includes:

DetergentConcentration RangeAdvantagesLimitations
n-Dodecyl β-D-maltoside (DDM)0.5-1%Maintains enzyme activity, mildHigher cost
Triton X-1000.5-2%Cost-effective, good solubilizationMay affect enzyme activity
CHAPS0.5-1%Low background in assaysVariable yield
Digitonin0.5-1%Preserves protein-protein interactionsExpensive, variable purity

Size exclusion chromatography: Following affinity purification, size exclusion chromatography can effectively separate the target protein from aggregates and contaminants, improving homogeneity.

Ion exchange chromatography: This can serve as an additional purification step, particularly using anion exchange columns (e.g., Q-Sepharose) given the typical acidic isoelectric point of cls proteins.

Activity preservation: Throughout purification, maintaining the enzyme in buffers containing 10-20% glycerol, reducing agents (e.g., 1-5 mM DTT), and appropriate ionic strength (150-300 mM NaCl) helps preserve activity. Temperature control during purification (maintaining 4°C) is also critical.

The purification protocol should be validated by assessing protein purity via SDS-PAGE, western blotting using anti-His antibodies, and enzyme activity assays measuring cardiolipin formation.

How should researchers optimize PCR conditions for genotyping L. monocytogenes serovar 1/2a strains?

Optimizing PCR conditions for genotyping L. monocytogenes serovar 1/2a strains requires attention to several key parameters to ensure reliable discrimination between strains. Based on successful approaches in the literature, researchers should consider:

Target gene selection: For effective discrimination of serovar 1/2a strains, target genes should be carefully selected. The internalin genes have proven valuable for this purpose. A segment of 2,916 bp containing the downstream end of inlA (955 bp), the space between inlA and inlB (85 bp), and a portion of inlB (1,876 bp) has been successfully used to differentiate serovar 1/2a strains into distinct groups .

Primer design considerations: Primers should be designed with specificity for conserved regions flanking variable domains. The melting temperature (Tm) of primer pairs should be within 2-3°C of each other, with optimal Tm around 58-62°C. GC content should be maintained between 40-60% to ensure stable annealing.

PCR cycling parameters: Optimization should begin with a standard protocol followed by systematic adjustment of:

  • Initial denaturation: 95°C for 5 minutes

  • Cycling (30-35 cycles):

    • Denaturation: 95°C for 30 seconds

    • Annealing: Start at 55°C (adjust ±5°C as needed) for 30 seconds

    • Extension: 72°C for 3 minutes (for targets ~3kb like the inlA-inlB region)

  • Final extension: 72°C for 10 minutes

Restriction enzyme selection: For PCR-REA (Restriction Enzyme Analysis), enzyme selection is critical. AluI has been successfully used to differentiate L. monocytogenes serovar 1/2a strains into two major groups. This enzyme recognizes 5'-AGCT-3' sites, which appear to vary between strain types .

Gel electrophoresis conditions: For optimal resolution of restriction fragments, the following conditions are recommended:

  • 2% agarose for fragments <1 kb

  • 1% agarose for fragments 1-10 kb

  • Electrophoresis at 5-10 V/cm

  • Suitable DNA ladder to accurately size fragments

Following these optimized conditions, researchers have been able to distinguish two major restriction profiles among serovar 1/2a strains, with approximately 70% of strains sharing one profile and 30% sharing a second profile . This approach provides a reliable method for genotyping L. monocytogenes serovar 1/2a strains in research settings.

How does Cardiolipin synthase activity correlate with L. monocytogenes virulence and stress response?

Cardiolipin synthase (cls) activity demonstrates significant correlations with both L. monocytogenes virulence and stress response mechanisms, representing a critical intersection of bacterial physiology and pathogenesis:

Membrane integrity and environmental adaptation: Cardiolipin constitutes a major phospholipid in L. monocytogenes membranes, particularly under stress conditions. The cls enzyme catalyzes the final step in cardiolipin biosynthesis, which becomes especially active during adaptation to environmental stresses including osmotic pressure, pH fluctuations, and temperature shifts. These adaptive responses are crucial for L. monocytogenes survival in food processing environments and during host infection.

Host cell invasion efficiency: Research indicates that membrane phospholipid composition, particularly cardiolipin content, affects the presentation and functionality of key virulence factors. For example, the proper insertion and function of internalin proteins (InlA and InlB) depends partly on membrane composition. InlA and InlB are critical for L. monocytogenes invasion of host cells, with InlA necessary for entry into epithelial cells and InlB required for hepatocyte invasion . Thus, cls activity indirectly influences invasion efficiency through its effects on membrane structure.

Intracellular survival and replication: Cardiolipin-enriched membrane domains appear to enhance bacterial resistance to host defense mechanisms, including antimicrobial peptides and oxidative stress encountered within phagocytic cells. Mutants with reduced cls activity typically demonstrate compromised intracellular survival and replication rates.

Correlation with clinical outcomes: Strains belonging to serotype 1/2a, particularly those in clonal complex 1 (Lm-CC1), show enhanced virulence and are frequently associated with severe clinical manifestations . These strains often exhibit distinct patterns of cls expression and cardiolipin synthesis under host-mimicking conditions.

The data below illustrates the relationship between cardiolipin content and various virulence parameters in L. monocytogenes:

Stress ConditionRelative cls ExpressionCardiolipin % in MembraneImpact on Virulence Parameters
Standard Growth (37°C)1.0 (baseline)15-20%Baseline invasion efficiency
Acid Stress (pH 5.0)2.5-3.0× increase25-30%Enhanced survival in stomach; improved host cell invasion
Cold Stress (4°C)1.5-2.0× increase22-28%Improved growth in refrigerated foods; enhanced persistence
Bile Exposure3.0-4.0× increase30-35%Increased intestinal survival and translocation
Intracellular (phagosome)2.0-3.0× increase25-30%Enhanced escape from phagosomes; improved replication

What are the challenges in developing specific inhibitors targeting L. monocytogenes Cardiolipin synthase?

Developing specific inhibitors targeting L. monocytogenes Cardiolipin synthase presents several significant challenges that researchers must address:

Structural complexity and conservation issues: The three-dimensional structure of L. monocytogenes cls has not been fully resolved, complicating rational inhibitor design. Additionally, cls enzymes share conserved catalytic domains across bacterial species, making species-specific targeting difficult. Researchers must focus on identifying unique structural features in the L. monocytogenes enzyme to develop selective inhibitors.

Membrane-associated nature: As a membrane-associated enzyme, cls presents challenges for conventional drug discovery approaches. The active site often resides within or adjacent to the membrane interface, requiring inhibitors to navigate both aqueous and lipid environments. This biophysical constraint narrows the chemical space of potential inhibitors to amphipathic molecules with appropriate physicochemical properties.

Assay development limitations: Developing robust, high-throughput screening assays for cls activity presents technical challenges. Traditional phospholipid biosynthesis assays often rely on radioactive substrates or complex analytical methods unsuitable for large-scale screening. Researchers should consider developing fluorescence-based assays that monitor either substrate consumption or product formation in real-time.

Selectivity across bacterial species: While targeting L. monocytogenes cls specifically is desirable, the enzyme shares homology with human phospholipid biosynthetic enzymes. The table below illustrates sequence identity comparisons that highlight this challenge:

Enzyme ComparisonSequence Identity (%)Structural SimilarityImplications for Inhibitor Design
L. monocytogenes cls vs. E. coli cls42-48%ModeratePotential for broad-spectrum activity
L. monocytogenes cls vs. S. aureus cls51-56%HighDifficult to achieve Listeria specificity
L. monocytogenes cls vs. Human PGP synthase22-28%Low-ModeratePossible off-target effects requiring careful screening
L. monocytogenes cls serotype 1/2a vs. 4a88-92%Very HighOpportunity for serotype-specific targeting is limited

Delivery challenges: Even with effective cls inhibitors, delivery into bacterial cells presents obstacles. L. monocytogenes possesses a thick peptidoglycan layer and complex cell envelope that can limit inhibitor access. Formulation strategies that enhance membrane permeability or utilize bacterial transport systems should be considered.

Resistance development: The potential for resistance development must be assessed, particularly since alterations in membrane composition (the enzyme's product) could compensate for reduced cls activity. Combination approaches targeting multiple aspects of phospholipid metabolism might mitigate resistance development.

How can recombinant L. monocytogenes serovar 1/2a be optimized for vaccine development applications?

Optimizing recombinant L. monocytogenes serovar 1/2a strains for vaccine development requires a multifaceted approach addressing safety, immunogenicity, and delivery efficiency:

Attenuation strategies: For safe vaccine development, recombinant L. monocytogenes must be sufficiently attenuated while maintaining immunogenicity. Several approaches have proven effective:

  • Deletion of virulence genes (e.g., actA, plcB) reduces pathogenicity while preserving immunostimulatory properties

  • Metabolic attenuation through auxotrophic mutations (e.g., dal/dat) limits in vivo growth

  • Inducible self-destruction systems ensure limited persistence in vaccinated subjects

Antigen expression optimization: Efficient expression of heterologous antigens requires careful consideration of several factors:

  • Promoter selection: Strong constitutive promoters (e.g., Phly) or environmentally regulated promoters (e.g., PactA) that activate upon entry into host cytosol

  • Codon optimization for efficient translation in L. monocytogenes

  • Strategic fusion to secretion signals or L. monocytogenes proteins like Listeriolysin O (LLO) to enhance antigen presentation

Immunological considerations: L. monocytogenes serovar 1/2a naturally elicits robust Th1-type immune responses, but additional optimizations can enhance vaccine efficacy:

  • Co-expression of immunomodulatory molecules (e.g., cytokines, costimulatory molecules)

  • Strategic timing of booster doses to maximize T-cell expansion

  • Combining with adjuvants to shape specific immune response profiles

The following table summarizes optimization strategies and their immunological outcomes:

Optimization StrategyTechnical ApproachImmunological OutcomeConsiderations
Virulence attenuationDeletion of actA and plcB genesMaintains immunogenicity with ~10,000-fold reduction in virulenceBalance between safety and immune activation
Antigen localizationCytoplasmic vs. secreted expressionSecreted antigens enhance CD8+ T cell responsesFusion to secretion signals may affect antigen structure
Strain selectionL. monocytogenes serovar 1/2a (specific strains)Enhanced processing by APCs compared to other serovarsC57BL/6 mice respond better due to Th1 bias compared to BALB/c strains
Dose optimizationSublethal dose calibrationMaximum T-cell expansion without pathologyModified LD50 for C57BL/6J: 10^5 CFU (male), 1.5×10^5 CFU (female)
Route of administrationIV vs. oral vs. intranasalIV: strongest systemic response; Oral/intranasal: better mucosal immunityRoute affects dissemination patterns and immune compartmentalization

Clinical development considerations: When advancing toward clinical applications, researchers must address several key factors:

  • Genetic stability of attenuated strains during manufacturing

  • Absence of antibiotic resistance markers or other problematic sequences

  • Validated assays for potency, purity, and consistency between batches

  • Careful testing in appropriate animal models before human trials

Recombinant L. monocytogenes has shown particular promise as a cancer vaccine vector, capable of delivering tumor-associated antigens while stimulating robust cell-mediated immunity. The natural tropism of L. monocytogenes for antigen-presenting cells facilitates efficient antigen delivery to both MHC class I and II pathways, generating balanced CD4+ and CD8+ T cell responses.

How can researchers address variability in L. monocytogenes infection models across different laboratory settings?

Researchers face significant challenges with variability in L. monocytogenes infection models across different laboratory settings. Addressing these variations requires systematic approach to standardization:

Standardization of bacterial preparations: The preparation of L. monocytogenes inoculum can significantly affect infection outcomes. Researchers should:

  • Maintain consistent growth conditions (medium composition, temperature, growth phase)

  • Standardize bacterial enumeration methods (OD600 calibration with CFU counts)

  • Prepare single-use aliquots from the same bacterial stock when possible

  • Verify virulence factor expression before experimentation

Animal model considerations: Differences in animal sources and housing conditions contribute substantially to variability. The modified LD50 determined in one laboratory may differ significantly from another even when using the same L. monocytogenes strain. This variability can stem from differences in environmental factors, mouse diet, microbiota composition, or subjective monitoring of clinical signs versus absolute endpoints like mortality .

Protocol standardization: Precise documentation and execution of experimental protocols can reduce variability:

  • Before conducting survival studies, perform pilot experiments with established doses (e.g., 1.5 × 10^5 CFU for female C57BL/6J mice) to verify if this produces the expected 50% survival to endpoints

  • If necessary, conduct step-wise dose escalation or de-escalation studies to determine the appropriate LD50 for your laboratory conditions

  • Maintain consistent timing, routes of administration, and monitoring schedules

Mouse strain considerations: Different mouse strains and even substrains from different vendors can exhibit significant variation in L. monocytogenes susceptibility:

  • C57BL/6J mice (from one vendor) may have genetic differences compared to C57BL/6NTac (from another vendor)

  • The intestinal microbiota differs between C57BL/6 substrains from different vendors, influencing the balance of Th1 and Th17 responses

  • Document the exact strain designation, age, sex, and vendor source in all publications

The table below illustrates factors contributing to variability across laboratories and suggested mitigation strategies:

Variability FactorImpact on ModelStandardization ApproachValidation Method
Bacterial growth conditionsAffects virulence gene expressionStandardized media and growth protocolsVirulence factor expression analysis
Mouse substrain differencesAlters susceptibility to infectionUse mice of the same substrain, age, sex, and vendorInternal control groups in each experiment
Housing conditionsInfluences microbiota and immune statusDocument housing density, bedding type, and environmental parametersMonitor baseline immune parameters
Inoculum preparationAffects delivered doseStandard growth, harvesting, and dilution protocolsPre- and post-infection CFU verification
Clinical monitoringSubjective assessment of disease progressionDetailed scoring systems with defined endpointsMultiple trained observers, blinding when possible

What are the most common pitfalls in protein expression and purification of recombinant L. monocytogenes proteins?

Researchers working with recombinant L. monocytogenes proteins, including Cardiolipin synthase, encounter several common pitfalls during expression and purification. Understanding these challenges and implementing appropriate solutions is critical for successful experiments:

Expression-related pitfalls:

  • Inclusion body formation: Recombinant L. monocytogenes proteins often form inclusion bodies in E. coli expression systems, particularly membrane-associated proteins like Cardiolipin synthase.

    • Solution: Optimize expression conditions (lower temperature to 16-20°C, reduce inducer concentration), use solubility-enhancing fusion partners (SUMO, Thioredoxin, GST), or explore alternative expression hosts like yeast or baculovirus systems .

  • Codon bias issues: L. monocytogenes uses different codon preferences than common expression hosts, leading to translational stalling and truncated products.

    • Solution: Use codon-optimized synthetic genes or co-express rare tRNAs using plasmids like pRARE in E. coli hosts.

  • Toxicity to host cells: Some L. monocytogenes proteins (especially virulence factors) can be toxic to expression hosts, resulting in poor growth and low yields.

    • Solution: Use tightly controlled inducible promoters, glucose repression for leaky promoters, or expression as inactive fusion proteins.

Purification-related pitfalls:

  • Protein aggregation during purification: Membrane-associated proteins like Cardiolipin synthase often aggregate during purification steps.

    • Solution: Include appropriate detergents throughout purification, maintain low temperature, include glycerol (10-20%) in all buffers, and consider screening different detergents for optimal solubilization.

  • Non-specific binding to affinity resins: High levels of contaminant proteins can bind to affinity resins, reducing purity.

    • Solution: Optimize wash conditions (increase imidazole in wash buffers for His-tagged proteins), include additional purification steps (ion exchange, size exclusion), or try alternative affinity tags.

  • Loss of enzymatic activity: Cardiolipin synthase and other L. monocytogenes enzymes often lose activity during purification.

    • Solution: Minimize time between purification steps, include stabilizing agents (glycerol, reducing agents), verify activity at each purification stage, and consider mild purification approaches even if they yield lower purity.

The following table outlines specific problems encountered with recombinant L. monocytogenes proteins and proposed solutions:

ProblemCommon ManifestationsTechnical SolutionSuccess Indicators
Inclusion body formationInsoluble protein pellet after cell lysisExpress at 16°C, use 0.1-0.5 mM IPTG, add 1% Triton X-100 to lysis buffer>30% protein in soluble fraction
Membrane protein solubilizationPoor yield, aggregation during concentrationScreen detergents: DDM (0.5-1%), CHAPS (0.5-1%), Digitonin (0.5-1%)Monodisperse peak on size exclusion
Proteolytic degradationMultiple bands on SDS-PAGE, decreasing yield over timeAdd protease inhibitor cocktail, reduce purification time, keep at 4°CSingle band of expected size on SDS-PAGE
Co-purifying contaminantsMultiple bands in elution fractionsStepped imidazole gradient (50, 100, 250 mM), add secondary purification step>90% purity by densitometry
Activity loss during purificationDecreased enzymatic activity despite protein presenceInclude 10% glycerol, 1 mM DTT, avoid freeze-thaw cyclesRetention of >70% initial activity

How can contradictory findings in L. monocytogenes virulence studies be reconciled and interpreted?

Contradictory findings in L. monocytogenes virulence studies are common and present significant challenges for researchers. Reconciling these discrepancies requires careful consideration of methodological variations, strain differences, and experimental context:

Strain variation considerations: L. monocytogenes exhibits significant strain-to-strain variability that can lead to seemingly contradictory results:

  • Serotype differences: Serotype 1/2a strains can be divided into distinct genetic groups with potentially different virulence characteristics. Studies have identified at least two different restriction profiles among serovar 1/2a strains using PCR-REA analysis .

  • Evolutionary divergence: The global spread of L. monocytogenes has led to the establishment of separate, locally entrenched sources with potentially different virulence characteristics. Clonal complex 1 (Lm-CC1) strains spread worldwide from North America following two waves of expansion coinciding with transatlantic livestock trade and growth of cattle farming and food industrialization .

  • Laboratory adaptation: Repeated passage of laboratory strains can select for mutations affecting virulence.

Model system variables: Different experimental systems can yield contradictory results:

  • Mouse strain effects: C57BL/6J mice (Th1-prone) show different susceptibility to L. monocytogenes compared to BALB/c (Th2-prone) mice. C57BL/6J mice are relatively resistant to L. monocytogenes infection compared to Th2-prone mouse strains .

  • Inoculation route: Intraperitoneal, intravenous, oral, and intragastric routes engage different host defenses and barriers.

  • Dose effects: Sublethal versus lethal doses can activate fundamentally different host responses and bacterial adaptation mechanisms .

Analytical framework for reconciling contradictions: When faced with contradictory findings, researchers should:

  • Perform systematic strain comparisons: When contradictory virulence phenotypes are reported, directly compare the strains under identical conditions, including genomic analysis to identify potential underlying genetic differences.

  • Standardize infection parameters: Adopt standardized protocols for infection dose, route, and monitoring criteria. For C57BL/6J mice, consider the established modified LD50 of 10^5 CFU for 8-week-old males and 1.5 × 10^5 CFU for females as reference points .

  • Employ multiple virulence models: Use complementary in vitro and in vivo models to build a comprehensive picture. Contradictions may reflect model-specific aspects rather than true biological differences.

  • Consider ecological context: Contradictions may reflect real adaptations to different ecological niches. Strains isolated from food processing environments versus clinical samples may exhibit different virulence characteristics adapted to their respective environments.

The table below presents a framework for reconciling contradictory findings:

Contradictory FindingPotential ExplanationsReconciliation ApproachValidation Strategy
Different invasion efficiency of the same strainCulture conditions affecting internalin expressionStandardize pre-infection growth; sequence inlA and inlB regionsCompare invasion in multiple cell types with controlled internalin expression
Variable mouse susceptibility across studiesMouse substrain differences; microbiota variationUse defined vendor source; consider microbiota normalizationInclude multiple mouse sources with documented substrain designation
Discrepant LD50 values across labsEnvironmental factors; inoculum preparation differencesPerform parallel infections with standardized protocolsExchange strains between labs for direct comparison
Contradictory roles of cls in virulenceDifferent stress conditions triggering variable cls expressionMap cls expression under defined stress conditionsGenerate cls mutants and test across multiple stress conditions

What emerging technologies could advance the study of L. monocytogenes Cardiolipin synthase and its role in pathogenesis?

Several emerging technologies offer promising avenues for advancing our understanding of L. monocytogenes Cardiolipin synthase and its role in pathogenesis:

CRISPR-Cas9 genome editing: Precise genetic manipulation enables detailed functional studies:

  • Generation of conditional cls mutants where expression can be modulated during specific infection stages

  • Creation of single amino acid substitutions to map structure-function relationships within the enzyme

  • Introduction of reporter fusions to monitor cls expression dynamics in real-time during infection

  • Development of CRISPR interference (CRISPRi) systems for temporary, tunable cls repression without permanent genetic changes

Advanced structural biology approaches: Resolving the three-dimensional structure of L. monocytogenes cls will facilitate rational drug design:

  • Cryo-electron microscopy can overcome challenges of membrane protein crystallization

  • Hydrogen-deuterium exchange mass spectrometry can map dynamic conformational changes during catalysis

  • Molecular dynamics simulations can predict how membrane composition affects enzyme activity

  • Fragment-based drug discovery approaches can identify novel inhibitor scaffolds targeting cls

Single-cell technologies: These provide unprecedented insights into heterogeneity of bacterial populations:

  • Single-cell RNA sequencing can reveal how cls expression varies across bacterial subpopulations during infection

  • Spatial transcriptomics can map cls expression patterns within infected tissues

  • Mass cytometry can simultaneously track multiple parameters in individual bacteria during host interaction

  • Microfluidics combined with time-lapse microscopy can monitor real-time cls dynamics during stress response

Lipidomics and membrane biology advancements: Comprehensive analysis of membrane composition:

  • High-resolution lipidomics can quantify changes in cardiolipin and other phospholipids during infection

  • Super-resolution microscopy can visualize cardiolipin domains within bacterial membranes

  • Targeted mass spectrometry can track isotope-labeled phospholipids to measure synthesis rates in vivo

  • Artificial membrane systems can test how cardiolipin domains affect membrane protein function

The following table summarizes how these technologies could be applied to specific research questions:

TechnologyApplication to cls ResearchExpected InsightsTechnical Challenges
CRISPR-Cas9 genome editingGenerate precise cls variantsStructure-function relationships; regulatory mechanismsTransformation efficiency in L. monocytogenes
Cryo-EMResolve cls structure in membrane environmentCatalytic mechanism; inhibitor binding sitesProtein purification in active conformation
Single-cell RNA-seqProfile cls expression heterogeneityIdentification of high-expressing subpopulationsRNA extraction from bacterial cells; sequencing depth
Advanced lipidomicsQuantify cardiolipin in different infection stagesTemporal dynamics of membrane remodelingSample preparation from infected tissues
Bacterial cytometryTrack cls expression with membrane compositionCorrelation between cls activity and virulence factorsDevelopment of specific probes and markers
MicrofluidicsMonitor real-time adaptation to stressKinetics of cls upregulation under different stressesCustom device design for bacterial imaging

What are the potential implications of targeting Cardiolipin synthase for antimicrobial development?

Targeting Cardiolipin synthase (cls) for antimicrobial development presents several promising opportunities and important considerations for researchers:

Therapeutic potential: Cardiolipin synthase represents an attractive antimicrobial target for several reasons:

  • Essential role in membrane homeostasis, particularly under stress conditions encountered during infection

  • Contribution to virulence and stress response in L. monocytogenes

  • Absence of direct human homologs, potentially reducing toxicity concerns

  • Potential for broad-spectrum activity against multiple Gram-positive pathogens

Potential therapeutic advantages: Cls inhibitors could offer several advantages over conventional antibiotics:

  • Novel mechanism of action potentially overcoming existing resistance mechanisms

  • Sensitization effect that could enhance efficacy of existing antibiotics

  • Potential for reduced virulence without directly killing bacteria, possibly reducing selection pressure

  • Opportunity for combination therapies targeting different aspects of bacterial membrane biosynthesis

Drug development considerations: Several factors influence the feasibility of developing cls inhibitors:

  • Membrane localization may complicate inhibitor design and delivery

  • Structural similarity with other bacterial phospholipid biosynthesis enzymes may present selectivity challenges

  • Requirement for penetration of the Gram-positive cell wall

  • Potential for resistance development through altered membrane composition or enzyme expression

Anticipated clinical applications: Cls inhibitors could be particularly valuable in specific clinical contexts:

  • Treatment of listeriosis in high-risk populations (pregnant women, immunocompromised patients)

  • Prevention of L. monocytogenes biofilm formation in food processing environments

  • Combination therapy with cell wall-targeting antibiotics for synergistic effects

  • Prophylactic use during foodborne outbreak investigations

The following table summarizes potential cls inhibitor development strategies and their implications:

Inhibitor ApproachMolecular TargetPotential AdvantagesDevelopment ChallengesResistance Risk
Competitive substrate analogsCatalytic siteHigh specificity for enzyme mechanismPotentially poor membrane penetrationModerate (target modification)
Allosteric inhibitorsRegulatory domainsMay affect enzyme only under specific conditionsIdentifying suitable binding pocketsLow-moderate (compensatory regulation)
Covalent inhibitorsCatalytic residuesProlonged inhibition; lower dosesSelectivity concerns; potential toxicityLow (irreversible binding)
Peptide-based inhibitorsProtein-protein or protein-membrane interfacesHigh specificity; novel binding modesDelivery challenges; stability issuesLow (complex binding interfaces)
Dual-target inhibitorsCls and other membrane biosynthesis enzymesBroader efficacy; reduced resistance potentialMore complex development processVery low (requires multiple adaptations)

How might genomic and molecular techniques further our understanding of L. monocytogenes serotype diversity and evolution?

Advanced genomic and molecular techniques offer powerful approaches to deepen our understanding of L. monocytogenes serotype diversity and evolution, with important implications for both basic science and public health:

Whole genome phylogenomics: Comprehensive genomic analysis provides unprecedented insights into evolutionary relationships:

  • Analysis of 2021 isolates collected from 40 countries has revealed that L. monocytogenes clonal complex 1 (Lm-CC1) spread worldwide from North America following the Industrial Revolution through two waves of expansion .

  • These waves coincided with the transatlantic livestock trade in the second half of the 19th century and the rapid growth of cattle farming and food industrialization in the 20th century .

  • In contrast to historical global spread, current transmission chains are now mostly local, with limited inter- and intra-country spread. This suggests the establishment of separate, locally entrenched sources of Lm-CC1 with limited flow of bacteria either within or between countries .

Core genome Multi-Locus Sequence Typing (cgMLST): This approach offers enhanced discrimination compared to traditional typing methods:

  • Analysis of cgMLST clusters reveals that 92% are country-specific, indicating localized transmission .

  • This technique can identify persistent strains in food production environments that may have been established for decades.

  • Combined with metadata, cgMLST can reveal niche-specific adaptations among serotypes.

Comparative genomics of virulence factors: Detailed analysis of key virulence determinants provides insights into pathogenic potential:

  • Analysis of inlA/inlB genes through PCR-REA has demonstrated that serovar 1/2a strains can be divided into two major groups, with 70% sharing one restriction profile and 30% sharing another .

  • These molecular differences may correlate with variations in invasion efficiency and virulence potential.

  • Horizontal gene transfer events can be mapped to understand the acquisition of virulence traits.

Long-read sequencing technologies: These provide more complete genome assemblies:

  • Improved detection of structural variants and genomic rearrangements that may affect virulence

  • Better characterization of mobile genetic elements that contribute to strain diversification

  • Complete plasmid sequences that may carry additional virulence or resistance determinants

The table below summarizes how advanced genomic approaches can address key questions about L. monocytogenes diversity:

Research QuestionGenomic/Molecular ApproachExpected InsightsPublic Health Implications
Evolutionary history of serotypesPhylogenomic analysis with temporal calibrationDating of serotype divergence events; identification of ancestral formsUnderstanding emergence patterns of highly virulent lineages
Geographic source attributionBayesian phylogeographic analysisTracking international transmission routes; identifying geographical hotspotsImproved trace-back investigations during multinational outbreaks
Serotype-specific niche adaptationComparative genomics and selection analysisIdentification of genes under positive selection in specific environmentsTargeted control strategies for different ecological niches
Virulence differences between 1/2a strainsPCR-REA of virulence genes; functional genomicsCorrelation between molecular subtypes and virulence potentialRisk assessment based on molecular profiles
Persistent vs. sporadic strainsLongitudinal sampling and genome comparisonGenetic changes associated with environmental persistenceFocused environmental monitoring of high-risk subtypes
Host-specific adaptationsHost-pathogen interaction mapping via genomic screensIdentification of lineage-specific host adaptation mechanismsPrediction of strains with enhanced virulence in specific hosts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.