Recombinant Listeria monocytogenes serovar 1/2a Cell wall teichoic acid glycosylation protein gtcA (gtcA)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Teichoic Acid Glycosylation

GtcA is essential for the glycosylation of two key cell wall polymers:

  1. Wall teichoic acid (WTA): Decorates WTA with N-acetylglucosamine (GlcNAc), critical for bacterial adhesion, biofilm formation, and phage adsorption .

  2. Lipoteichoic acid (LTA): Transfers galactose residues to LTA, influencing membrane integrity and resistance to host antimicrobial peptides (AMPs) .

Mechanistically, GtcA acts as a flippase, translocating lipid-linked sugar precursors (e.g., C55-P-galactose) across the cytoplasmic membrane for extracellular polymerization .

Role in Virulence and Host Interaction

  • Antimicrobial resistance:

    • GtcA-mediated glycosylation enhances resistance to AMPs (e.g., LL-37) by reducing cell wall permeability .

    • Double mutants lacking both WTA-GlcNAc and LTA-galactose show 10–100× increased susceptibility to AMPs .

  • Virulence factor anchoring:

    • Indirectly supports surface localization of adhesion proteins (e.g., Ami, InlB) via WTA glycosylation .

Comparative Analysis Across Serovars

FeatureSerovar 1/2aSerovar 4b
GtcA homolog identity80–82% nucleotide similarity to serovar 4b Original gtcA characterized in serovar 4b
TA glycosylationWTA (GlcNAc) and LTA (galactose) WTA (galactose/glucose)
Phage susceptibilityLimited data; LMUP121 resistance reported A500/A511 phage resistance confirmed

Applications in Research

  • Drug target exploration:

    • GtcA’s role in AMP/antibiotic resistance highlights its potential as a therapeutic target .

  • Structural studies:

    • Recombinant GtcA facilitates biochemical assays to map flippase mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
gtcA; lmo2549; Cell wall teichoic acid glycosylation protein GtcA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
gtcA
Target Protein Sequence
MNKIRKWLDKIPWYTDEIHSILMYLIMGGFTTLINIVTFWLCTYVLNWDYRIANTIAWVA SVLFAYFSNKKYVFESYTPTWKERAREVTSFFGFRFLTYLVDILVMILLIEVLSINELWA KIWTNVIVLVLNYVFSKWIIFKVKK
Uniprot No.

Target Background

Function
Involved in the decoration of cell wall teichoic acid with galactose and glucose.
Gene References Into Functions
  1. Teichoic acid glycosylation mediated by gtcA is required for phage adsorption and susceptibility in Listeria monocytogenes serotype 4b. PMID: 18192405
Database Links

KEGG: lmo:lmo2549

STRING: 169963.lmo2549

Protein Families
GtrA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of gtcA in Listeria monocytogenes cell wall structure?

GtcA is a novel gene involved in the decoration of cell wall teichoic acid with specific sugar moieties. In serotype 4b strains, gtcA has been definitively shown to facilitate the addition of galactose and glucose to teichoic acid structures . Interestingly, when researchers conducted insertional inactivation of gtcA, they observed a complete absence of galactose and significantly reduced glucose content on teichoic acid. This glycosylation pattern is critical for cell wall integrity and serotype-specific antigenic properties .

The functional significance of this glycosylation extends beyond structural considerations. The modification of teichoic acids affects cell surface properties that influence host-pathogen interactions. Methodology to determine this function typically involves chemical analysis of purified cell wall components from wild-type and mutant strains, followed by comparative sugar composition analysis using techniques such as gas chromatography-mass spectrometry or high-performance liquid chromatography.

How does gtcA distribution vary across different Listeria monocytogenes serotypes?

The distribution of gtcA shows clear serotype specificity within L. monocytogenes. Sequence analysis has revealed that homologous sequences to gtcA are found in all serogroup 4 isolates but are notably absent in strains belonging to other serotypes . This serotype-specific distribution suggests that gtcA plays a role in defining the antigenic characteristics that distinguish serogroup 4 from other L. monocytogenes serotypes.

In serotype 4b specifically, gtcA appears to be organized as the first member of a bicistronic operon. The second gene in this operon shows homology to Bacillus subtilis rpmE, which encodes ribosomal protein L31 . Unlike gtcA, this second gene appears to be conserved across all screened serotypes of L. monocytogenes, suggesting differential evolutionary pressures on these adjacently located genes.

What methodological approaches are used to analyze teichoic acid glycosylation patterns?

Analyzing teichoic acid glycosylation patterns requires a multi-step methodological approach:

  • Isolation of cell wall components: Differential extraction techniques separate wall teichoic acids (WTAs) from lipoteichoic acids (LTAs).

  • Purification steps: Including ion-exchange chromatography and gel filtration.

  • Compositional analysis: Hydrolysis followed by sugar analysis using techniques such as:

    • Gas chromatography coupled with mass spectrometry (GC-MS)

    • High-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD)

  • Structural determination: NMR spectroscopy for detailed structural characterization

When analyzing glycosylation patterns, researchers must carefully compare wild-type strains with isogenic mutants to identify specific alterations in sugar composition. For example, studies have shown that gtcA inactivation results in complete loss of galactose and reduced glucose on teichoic acid while leaving the composition of membrane-associated lipoteichoic acid unaffected .

How do researchers generate and verify gtcA mutants in Listeria monocytogenes?

The construction of gtcA mutants follows several critical steps to ensure proper gene inactivation and verification:

  • Gene targeting strategy: Researchers typically amplify approximately 1 kb DNA fragments both upstream and downstream of the gtcA gene using specific primer pairs (e.g., for gtcA deletion, primers like ANG2979/2980 and ANG2981/2982) .

  • Fragment fusion: The resulting PCR products are fused through a second PCR using primers that span the entire region (e.g., ANG2979/2982) .

  • Plasmid construction: The fused fragments are digested with appropriate restriction enzymes (e.g., BamHI and KpnI) and ligated into a suitable vector such as pKSV7 .

  • Transformation and selection: The constructed plasmids are first recovered in E. coli before being electroporated into L. monocytogenes. The target gene is then deleted through allelic exchange, yielding the desired mutant strain (e.g., 10403SΔgtcA) .

  • Verification: Deletion mutants are verified through PCR analysis and often confirmed through phenotypic testing, such as reactivity with serotype-specific antibodies or analysis of teichoic acid composition .

For complementation studies, expression plasmids (e.g., pIMK3-gtcA) are constructed to enable controlled expression of gtcA, typically under an IPTG-inducible promoter. This approach allows researchers to confirm that observed phenotypes are specifically associated with gtcA function rather than polar effects or secondary mutations .

What are the methodological approaches for studying gtcA's impact on bacterial virulence?

Investigating gtcA's impact on virulence requires multiple complementary approaches:

  • In vivo infection models:

    • Intragastric infection of anesthetized mice (e.g., A/J mice) to assess gastrointestinal virulence

    • Intravenous inoculation to evaluate systemic spread and organ colonization

    • Quantification of bacterial loads in various organs (spleen, liver, ceca, gall bladder) at defined time points post-infection

  • Cell culture infection models:

    • Human intestinal epithelial cell lines (e.g., Caco-2)

    • Assessment of invasion efficiency through gentamicin protection assays

    • Measurement of intracellular multiplication rates

  • Comparative analysis:

    • Side-by-side evaluation of wild-type, mutant, and complemented strains

    • Statistical analysis to determine significance of observed differences

Research has demonstrated that gtcA mutants show decreased virulence following both intragastric and intravenous infections, with lower bacterial recovery from multiple organs compared to parent strains. Specifically, gtcA mutants exhibit decreased invasion capabilities in Caco-2 cells while maintaining normal intracellular multiplication rates once inside cells .

How does gtcA's involvement in teichoic acid glycosylation differ between wall teichoic acids and lipoteichoic acids?

This apparent discrepancy highlights several critical considerations:

  • Methodological differences: Earlier studies may have used different extraction and analysis techniques that affected the detection of subtle changes in LTA glycosylation.

  • Strain-specific effects: The impact of gtcA may vary between different L. monocytogenes strains and serotypes.

  • Regulatory networks: The relationship between WTA and LTA biosynthesis pathways may involve compensatory mechanisms that are differentially activated in various experimental conditions.

To definitively characterize these differences, researchers should employ comprehensive structural analysis of both WTA and LTA from wild-type and mutant strains using state-of-the-art techniques such as NMR spectroscopy and mass spectrometry, complemented by functional studies of respective glycosyltransferase activities.

What are the molecular mechanisms by which gtcA mutations affect invasion capabilities?

The decreased invasion capabilities observed in gtcA mutants present an intriguing research question regarding the underlying molecular mechanisms. Several hypotheses warrant investigation:

  • Altered recognition by host receptors: The absence of specific sugar moieties on teichoic acids may impair recognition by host cell receptors that facilitate bacterial attachment and subsequent invasion.

  • Changes in surface protein presentation: Modifications in cell wall glycosylation could affect the proper localization or conformation of key invasion-associated proteins such as internalins.

  • Altered cell wall rigidity and flexibility: The glycosylation status of teichoic acids influences cell wall physical properties, potentially affecting the mechanical aspects of the invasion process.

  • Immunological recognition: Changes in surface glycosylation may alter interactions with host immune components, indirectly affecting invasion efficiency.

Research approaches to address these questions should include:

  • Protein localization studies using fluorescence microscopy

  • Surface protein extraction and quantification

  • Biophysical measurements of cell wall properties

  • Host-pathogen interaction assays with specific receptor blocking

How do specific point mutations in gtcA affect its function in teichoic acid glycosylation?

Analysis of the gtcA protein through site-directed mutagenesis provides insights into critical functional domains. Research has examined several point mutations, including A65S, N69A, V73A, F74A, F91A, R95A, K121A, and N132A . These studies help identify amino acid residues essential for gtcA's glycosylation function.

MutationEffect on GlycosylationPotential Structural/Functional Implication
A65SPartial inhibitionLocated in potential membrane-spanning domain
N69ASignificant reductionPossible involvement in sugar substrate recognition
F74AComplete loss of functionCritical for protein folding or active site structure
R95AMinimal effectLocated in non-essential region
K121ASignificant reductionPotential involvement in substrate binding

The methodology for these studies typically involves:

  • PCR-based site-directed mutagenesis

  • Construction of expression plasmids carrying mutated versions of gtcA

  • Complementation of gtcA deletion strains with these constructs

  • Functional assessment through teichoic acid composition analysis and virulence assays

This structure-function analysis is critical for understanding the molecular mechanisms of gtcA-mediated glycosylation and may inform strategies for targeting this process in antimicrobial development.

What are the common technical challenges in expressing and purifying recombinant gtcA protein?

Researchers working with recombinant gtcA face several technical challenges:

  • Membrane association: GtcA appears to be membrane-associated, which complicates extraction and purification procedures. Using detergent-based extraction methods (e.g., with Triton X-100 or n-dodecyl β-D-maltoside) with careful optimization of detergent concentration is critical.

  • Protein stability: The protein may exhibit instability during purification. Adding glycerol (10-15%) and reducing agents to buffers can help maintain protein integrity.

  • Expression systems: Heterologous expression in E. coli may lead to inclusion body formation. Consider using:

    • Lower induction temperatures (16-20°C)

    • Fusion tags that enhance solubility (SUMO, MBP)

    • L. monocytogenes-based expression systems for more native-like post-translational modifications

  • Functional verification: Confirming that the purified recombinant protein retains glycosylation activity requires developing appropriate in vitro assays with relevant substrates.

For improved purification, researchers have used histidine-tagged versions of gtcA (His-gtcA), enabling affinity chromatography purification . This approach facilitates both in vitro activity assays and structural studies.

How can researchers address serotype differences when studying gtcA in serovar 1/2a versus 4b?

The serotype-specific nature of gtcA presents particular challenges when translating findings between serovar 4b and 1/2a:

  • Sequence comparison: Conduct thorough bioinformatic analysis to identify potential gtcA homologs or functional analogs in serovar 1/2a, even with limited sequence similarity.

  • Heterologous expression: Express serovar 4b gtcA in serovar 1/2a background to assess functional complementation and potential glycosylation differences.

  • Comparative glycosylation analysis: Perform detailed structural analysis of teichoic acids from both serotypes to determine:

    • Sugar composition differences

    • Linkage variations

    • Alternative glycosylation enzymes that may function in serovar 1/2a

  • Genetic screening approaches: Consider using transposon mutagenesis or CRISPR-Cas9 screens in serovar 1/2a to identify genes involved in teichoic acid glycosylation that may functionally substitute for gtcA.

When publishing research, clearly distinguish between findings specific to serovar 4b versus those applicable to serovar 1/2a to prevent confusion in the field.

What genomic approaches would help elucidate the evolutionary significance of gtcA in different Listeria strains?

Advanced genomic approaches can provide deeper insights into gtcA evolution:

  • Comparative genomics: Analyzing gtcA and surrounding genomic regions across a large collection of Listeria strains representing different serotypes, ecological niches, and virulence potentials.

  • Phylogenetic analysis: Constructing phylogenetic trees based on gtcA sequences to trace evolutionary relationships and potential horizontal gene transfer events.

  • Population genetics: Examining selection pressures on gtcA through analysis of synonymous vs. non-synonymous mutations (dN/dS ratios).

  • Pangenome analysis: Determining whether gtcA is part of the core or accessory genome across Listeria species and strains.

  • Transcriptional regulation: Investigating regulatory mechanisms that control gtcA expression under different environmental conditions using techniques like RNA-seq and ChIP-seq.

These approaches would help address key questions such as:

  • Why is gtcA present in serogroup 4 but absent in other serotypes?

  • How does gtcA contribute to ecological adaptation in different environments?

  • What selective pressures maintain or modify gtcA function in pathogenic versus non-pathogenic Listeria species?

How might knowledge of gtcA function inform development of novel anti-Listeria strategies?

Understanding gtcA function opens several avenues for novel anti-Listeria strategies:

  • Targeted inhibitors: The essential role of gtcA in virulence makes it a potential target for small molecule inhibitors that could reduce pathogenicity without directly killing bacteria, potentially reducing selection pressure for resistance.

  • Diagnostic applications: The serotype-specific nature of gtcA could be exploited for improved diagnostic methods to distinguish between serotypes with different virulence potentials.

  • Vaccine development: Modified strains with altered teichoic acid glycosylation patterns could serve as live attenuated vaccine candidates or as vehicles for delivering heterologous antigens.

  • Host-pathogen interaction modulators: Understanding how specific glycosylation patterns influence host recognition could inform strategies to block critical interactions during infection.

Research approaches should include:

  • High-throughput screening of chemical libraries for gtcA inhibitors

  • Rational drug design based on protein structure (once determined)

  • Preclinical evaluation of modified strains as vaccine candidates

  • Development of glycosylation-specific detection methods

What integrated methodological approaches would best elucidate the complex relationship between teichoic acid glycosylation and Listeria pathogenesis?

A comprehensive understanding of how teichoic acid glycosylation affects Listeria pathogenesis requires integrated multi-disciplinary approaches:

  • Systems biology: Combining transcriptomics, proteomics, and metabolomics to understand the broader impact of altered teichoic acid glycosylation on bacterial physiology and host responses.

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize glycosylation patterns across the cell surface

    • Live cell imaging to track dynamics during host cell interaction

    • Correlative light and electron microscopy to connect molecular patterns with ultrastructural features

  • Synthetic biology approaches:

    • Engineering strains with modified glycosylation patterns

    • Creating conditional mutants to study temporal aspects of glycosylation

    • Developing reporter systems for glycosylation efficiency

  • Host-pathogen interface studies:

    • Single-cell analysis of host responses to differently glycosylated strains

    • Organoid models to assess tissue-specific effects

    • In vivo imaging in animal models to track infection dynamics

  • Computational modeling:

    • Molecular dynamics simulations of glycosylated versus non-glycosylated teichoic acids

    • Predictive models of host recognition and immune activation

By integrating these approaches, researchers can develop more comprehensive models of how specific glycosylation patterns contribute to virulence in different host environments and infection stages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.