Recombinant Listeria monocytogenes serovar 1/2a Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please inform us during ordering to prioritize its implementation.
Synonyms
cobS; lmo1148; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
cobS
Target Protein Sequence
MKTLILLIQFFTRIPLPIQINMDEINLKKGSALLPFVGVIIGAWNWLIFTLVALVMPLPV AIIAGLFAEVIITGGFHVDALADTADGLFSSRKRERMLEIMKDSRVGANGVIAICFYFLF YGALFLSVTDTQQICWLFFVLPIVAKGVTMLLFAKMTYAGSKEGLGSIFLGVPWWPIVIA QVIVLAVLGLFFSYVGVIAYVGVILFTIIYRAFVYKRIGGMNGDTLGAGGQMGQLICLFC LVLLWGLV
Uniprot No.

Target Background

Function

This enzyme catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.

Database Links

KEGG: lmo:lmo1148

STRING: 169963.lmo1148

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria monocytogenes serovar 1/2a and why is it significant in research?

Listeria monocytogenes serovar 1/2a is a specific serotype of the gram-positive facultative intracellular pathogen L. monocytogenes. This serotype has gained significant research attention due to its increasing prevalence in human listeriosis cases. While serovar 4b strains have historically been associated with most listeriosis outbreaks, evidence indicates serogroup 1/2 strains have become increasingly prevalent in human cases and are frequently isolated during routine food examinations . The serovar 1/2a strain ATCC BAA-679/EGD-e is a commonly used reference strain in research settings, with its genome fully sequenced and annotated .

Listeriosis, the disease caused by L. monocytogenes, typically manifests as bacteremia, meningitis or meningoencephalitis, and pregnancy-associated infections that can lead to miscarriage or neonatal sepsis. It represents a significant public health concern as one of the main causes of foodborne illness requiring hospitalization in Western countries .

Genotypic characterization of L. monocytogenes serovar 1/2a has revealed two distinct genetic profiles (designated as 1/2a:I and 1/2a:II) based on restriction enzyme analysis of PCR products from virulence-associated genes. This genetic diversity may have implications for pathogenicity and evolutionary relationships among strains .

What is Cobalamin synthase (cobS) and what function does it serve in L. monocytogenes?

Cobalamin synthase (cobS) is an enzyme involved in the final stages of cobalamin (vitamin B12) biosynthesis. In L. monocytogenes serovar 1/2a, cobS is encoded by the gene lmo1148 . The enzyme functions as a cob(I)yrinic acid a,c-diamide adenosyltransferase, converting cobalamin into adenosylcobalamin (AdoCbl), which serves as a cofactor for multiple enzymes .

The protein consists of 248 amino acids and contains characteristic domains for cobalamin binding and adenosylation activity. Its structure enables the conversion of the inactive form of vitamin B12 into its metabolically active form, adenosylcobalamin, which is essential for various metabolic processes .

While fungi and plants were traditionally considered devoid of cobalamin utilization pathways, recent research has demonstrated that cobalamin is utilized by non-Dikarya fungal lineages. This suggests that cobalamin dependence was likely a widespread trait across diverse microbial eukaryotes and possibly present in the last eukaryotic common ancestor (LECA) .

The importance of cobalamin in L. monocytogenes metabolism relates to its role as a cofactor for enzymes like methylmalonyl-CoA mutase, which catalyzes the conversion of methylmalonyl-CoA to succinyl-CoA—a key component of the citric acid cycle. This metabolic function may contribute to the bacterium's ability to survive and proliferate in various environmental conditions and within host cells .

What are the optimal conditions for storage and handling of recombinant Cobalamin synthase (cobS)?

Recombinant Listeria monocytogenes serovar 1/2a Cobalamin synthase requires specific storage conditions to maintain structural integrity and enzymatic activity. The recommended storage protocol involves:

  • Primary storage at -20°C for routine use

  • Extended storage at -80°C for long-term preservation

  • Working aliquots should be maintained at 4°C for up to one week only

  • Storage buffer typically consists of a Tris-based buffer with 50% glycerol, specifically optimized for protein stability

Repeated freeze-thaw cycles are strongly discouraged as they can lead to protein denaturation and loss of enzymatic activity. Therefore, it is advisable to prepare single-use aliquots upon initial thawing of the stock preparation .

For handling during experimental procedures, recombinant cobS should be maintained on ice when removed from storage, and exposure to room temperature should be minimized. The enzyme's stability at room temperature has not been extensively characterized, so caution is advised during experimental manipulations requiring extended periods at ambient conditions.

How can researchers effectively measure the enzymatic activity of recombinant Cobalamin synthase?

Measuring the adenosyltransferase activity of recombinant Cobalamin synthase requires specialized methodological approaches that account for the complex nature of the reaction. A comprehensive protocol typically involves:

Spectrophotometric Assay:

  • Reaction mixture preparation containing:

    • Purified recombinant cobS (1-5 μg)

    • Hydroxocobalamin substrate (50-100 μM)

    • ATP (200-500 μM)

    • Reducing agent (glutathione or DTT, 5 mM)

    • MgCl₂ (5-10 mM)

    • Appropriate buffer system (typically HEPES or Tris, pH 7.5-8.0)

  • Activity measurement via:

    • Monitoring the conversion of hydroxocobalamin to adenosylcobalamin through spectral changes (525 nm to 458 nm shift)

    • Rate calculation based on the decrease in absorbance at 525 nm over time

    • Comparison to standard curves generated using commercial adenosylcobalamin

HPLC-Based Detection:
For more precise quantification, researchers can employ HPLC separation of reaction products using:

  • C18 reverse-phase column

  • Mobile phase consisting of methanol:water gradient

  • Detection at 361 nm (characteristic for adenosylcobalamin)

  • Internal standards for calibration

This method provides superior sensitivity and specificity compared to spectrophotometric approaches, allowing for detection of enzyme activity even with low protein concentrations or in the presence of potential inhibitors.

What is the relationship between cobS function and Listeria monocytogenes virulence?

The relationship between Cobalamin synthase function and virulence in L. monocytogenes represents an emerging area of research with significant implications for understanding bacterial pathogenesis. Current evidence suggests several potential mechanisms:

  • Metabolic Adaptation During Infection:
    Adenosylcobalamin produced by cobS serves as a cofactor for methylmalonyl-CoA mutase, which catalyzes the conversion of methylmalonyl-CoA to succinyl-CoA. This reaction is crucial for:

    • Propionate metabolism

    • Odd-chain fatty acid utilization

    • Alternative carbon source processing during host colonization

  • Connection to Intracellular Survival:
    The ability of L. monocytogenes to survive within host cells may be partially dependent on cobS-mediated metabolic pathways. The bacterium's adaptation to nutrient-limited intracellular environments could be supported by vitamin B12-dependent enzymes that provide metabolic flexibility .

  • Potential Interplay with Virulence Genes:
    While direct evidence linking cobS to classical virulence factors is limited, research has documented genetic clustering patterns where metabolic genes like cobS may be co-regulated with virulence factors. The presence of certain cobalamin-dependent metabolic pathways appears to correlate with the expression of virulence genes in specific environmental conditions.

Experimental approaches to investigate this relationship include:

MethodologyApplicationExpected Outcome
Gene knockoutCreation of ΔcobS mutantsAssessment of virulence attenuation in cell culture and animal models
Complementation studiesRestoration of cobS functionConfirmation of virulence phenotype attributable to cobS
TranscriptomicsRNA-seq under infection-relevant conditionsIdentification of co-regulated genes and pathways
MetabolomicsProfiling of B12-dependent metabolitesCharacterization of metabolic shifts during infection

These approaches collectively provide a framework for understanding how cobS function may contribute to L. monocytogenes pathogenicity beyond its basic metabolic role.

How does genetic diversity in the cobS gene correlate with L. monocytogenes strain typing?

Genetic diversity in the cobS gene (lmo1148) offers potential insights for strain typing and evolutionary analysis of L. monocytogenes isolates. Research on serovar 1/2a strains has demonstrated:

Methodological Approaches for cobS-Based Strain Typing:

  • Single nucleotide polymorphism (SNP) analysis:

    • Targeted sequencing of the cobS coding region

    • Identification of synonymous vs. non-synonymous substitutions

    • Correlation of specific SNPs with virulence phenotypes

  • Restriction fragment length polymorphism (RFLP) analysis:

    • PCR amplification of cobS and flanking regions

    • Digestion with informative restriction enzymes (e.g., AluI)

    • Gel electrophoresis pattern analysis for strain differentiation

  • Integration with multilocus sequence typing (MLST):

    • Inclusion of cobS in MLST schemes

    • Correlation of cobS sequence types with established clonal complexes

    • Assessment of cobS as a marker for specific evolutionary lineages

These approaches would complement existing typing methods and potentially provide additional resolution for epidemiological investigations and evolutionary studies of L. monocytogenes.

What structural features of Cobalamin synthase enable its catalytic function?

The catalytic function of Cobalamin synthase (cobS) from L. monocytogenes serovar 1/2a depends on specific structural features that facilitate the adenosylation of cobalamin. Key structural elements include:

  • ATP-Binding Domain:

    • Conserved P-loop motif for ATP coordination

    • Magnesium-binding residues essential for ATP hydrolysis

    • Conformational changes upon ATP binding that position the substrate

  • Cobalamin-Binding Pocket:

    • Specialized binding site that accommodates the complex corrin ring structure

    • Coordination of the central cobalt atom

    • Specific interactions with side chains of the corrin ring

  • Catalytic Triad:

    • Three conserved amino acid residues forming the catalytic center

    • Precise positioning of cobalamin and ATP for nucleophilic attack

    • Acid-base catalysis mechanism for adenosyl transfer

The catalytic mechanism involves several coordinated steps:

  • Binding of cobalamin substrate in the active site

  • Coordination of ATP in proximity to the cobalamin

  • Reduction of the cobalt center from Co(III) to Co(I)

  • Nucleophilic attack of the Co(I) species on the 5'-carbon of ATP

  • Formation of the cobalt-carbon bond characteristic of adenosylcobalamin

  • Release of the adenosylated product

Understanding these structural determinants is crucial for studies aimed at inhibitor design and functional characterization of the enzyme.

How can recombinant Cobalamin synthase be utilized in antimicrobial development?

The essential role of cobalamin in L. monocytogenes metabolism positions Cobalamin synthase (cobS) as a potential target for novel antimicrobial strategies. Several research applications include:

  • Structure-Based Inhibitor Design:

    • Virtual screening against the cobS active site

    • Fragment-based drug discovery approaches

    • Development of transition-state analogs that mimic the adenosylation reaction

  • High-Throughput Screening Platforms:
    Using purified recombinant cobS for inhibitor discovery:

    • Fluorescence-based activity assays adaptable to 384-well format

    • Displacement assays using fluorescently labeled cobalamin analogs

    • Thermal shift assays to identify stabilizing compounds

  • Metabolic Intervention Strategies:

    • Targeting B12-dependent pathways unique to bacterial metabolism

    • Development of prodrugs activated by cobS

    • Combination approaches targeting multiple steps in cobalamin utilization

Current limitations that researchers should address include:

  • Insufficient structural data on L. monocytogenes cobS (most structural insights derive from homology models)

  • Limited understanding of species-specific features that could be exploited for selectivity

  • Incomplete characterization of the essentiality of cobS under different growth conditions

What are the current gaps in understanding cobS function in Listeria pathogenesis?

Despite advances in our understanding of cobalamin metabolism, significant knowledge gaps remain regarding cobS function in Listeria pathogenesis:

  • Temporal Expression Patterns:

    • Expression levels of cobS during different stages of infection

    • Regulatory mechanisms controlling cobS expression in response to host environments

    • Post-translational modifications affecting enzymatic activity in vivo

  • Host-Pathogen Interactions:

    • Competition between host and pathogen for cobalamin resources

    • Potential recognition of cobS or its products by host immune receptors

    • Interactions with host B12 transport and utilization machinery

  • Strain-Specific Variations:

    • Functional differences in cobS between hypervirulent and less virulent strains

    • Correlation between cobS sequence variants and clinical outcomes

    • Evolution of cobS in the context of host adaptation

  • Metabolic Networks:

    • Complete mapping of B12-dependent pathways in L. monocytogenes

    • Integration of cobalamin metabolism with central carbon metabolism

    • Metabolic flux during infection and stress conditions

Addressing these gaps requires innovative experimental approaches:

  • Systems biology integration of transcriptomics, proteomics, and metabolomics data

  • Development of genetic tools for conditional cobS expression

  • In vivo imaging techniques to track B12 utilization during infection

  • Comparative analyses across diverse L. monocytogenes strains

What experimental challenges exist in expressing functional recombinant Cobalamin synthase?

Researchers working with recombinant Cobalamin synthase face several technical challenges that must be addressed for successful expression and purification of functional enzyme:

  • Expression System Selection:
    Different expression systems present varying advantages and limitations:

    Expression SystemAdvantagesLimitations
    E. coliHigh yield, simplicityPotential misfolding, inclusion body formation
    YeastPost-translational modificationsLower yield, complex media requirements
    BaculovirusNative-like foldingTime-consuming, technically demanding
    Cell-freeRapid, accommodates toxic proteinsExpensive, lower yield
  • Solubility and Folding:

    • Cobalamin synthase may form inclusion bodies, requiring optimization of:

      • Induction temperature (typically lowered to 16-20°C)

      • IPTG concentration (reduced to 0.1-0.5 mM)

      • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

      • Fusion partners (MBP, SUMO, thioredoxin)

  • Cofactor Requirements:

    • Addition of cobalt salts to expression media

    • Supplementation with precursors of the adenosylation reaction

    • Incorporation of ATP or analogs during purification

  • Purification Strategies:

    • Multi-step purification typically required:

      1. Initial capture via affinity chromatography (His-tag, GST, MBP)

      2. Ion exchange chromatography for intermediate purification

      3. Size exclusion chromatography for final polishing

    • Buffer optimization to maintain stability (typically containing 10-20% glycerol)

  • Activity Preservation:

    • Protection from oxidation using reducing agents (DTT, β-mercaptoethanol)

    • Addition of stabilizing agents (glycerol, arginine, trehalose)

    • Avoidance of freeze-thaw cycles by preparing single-use aliquots

Researchers should consider these factors when designing expression constructs and purification protocols to ensure the production of functionally active enzyme suitable for biochemical and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.