Recombinant Listeria monocytogenes serovar 1/2a DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of FtsK in L. monocytogenes

DNA translocase FtsK is a critical ATP-dependent enzyme involved in bacterial chromosome segregation and cell division. In Listeria monocytogenes serovar 1/2a, the ftsK gene encodes a protein essential for resolving chromosomal DNA during septation, ensuring proper partitioning of genetic material into daughter cells . Recombinant FtsK refers to the genetically engineered form of this protein, typically expressed in heterologous systems like Escherichia coli for functional studies .

Functional Roles in L. monocytogenes Physiology and Pathogenesis

FtsK is indispensable for bacterial survival and virulence:

  • Chromosome Segregation: Resolves dimeric chromosomes via XerCD-mediated recombination at the dif site .

  • Cell Division: Coordinates with divisome proteins (e.g., FtsZ) to ensure septal DNA clearance .

  • Stress Adaptation: Linked to survival under nutrient-limiting conditions and cell wall stress, as shown in lineage II serovar 1/2a strains .

Table 1: Phenotypic Impacts of ftsK Mutations in L. monocytogenes

Mutation TypeObserved PhenotypeStrain/SerotypeSource
Frameshift deletionDefective cell division, filamentation10403S (1/2a)
Missense (LMRG_00545)Reduced virulence in murine modelsLineage II (1/2a)

Recombinant FtsK Production and Applications

Recombinant FtsK is produced via cloning the ftsK gene into expression vectors (e.g., pET systems) followed by purification using affinity chromatography .

Biotechnological Uses:

  • DNA Translocation Assays: Used to study ATP-driven DNA pumping mechanisms .

  • Antibiotic Target Screening: Evaluated for interactions with cell division inhibitors .

  • Vaccine Development: Engineered Listeria strains expressing recombinant FtsK are explored as vectors for heterologous antigen delivery .

Table 2: Key Parameters for Recombinant FtsK Expression

ParameterSpecificationSource
Expression HostE. coli BL21(DE3)
Purity>90% (SDS-PAGE verified)
Storage-80°C in Tris/PBS buffer with 6% trehalose

Research Findings and Comparative Genomics

Comparative studies highlight serovar-specific variations in FtsK functionality:

  • Lineage-Specific Adaptations: Lineage II (serovar 1/2a) strains show enhanced FtsK expression under stress compared to lineage I .

  • Phage Resistance: Mutations in ftsK correlate with altered susceptibility to bacteriophages (e.g., LP-048 and LP-125) .

  • Metabolic Regulation: FtsK interacts with PASTA kinase PrkA to modulate cell wall homeostasis .

Challenges and Future Directions

While recombinant FtsK has advanced our understanding of L. monocytogenes biology, gaps remain:

  • Structural Resolution: No crystal structure exists for Listeria FtsK; homology modeling relies on C. perfringens templates .

  • Pathogenicity Links: Direct evidence linking FtsK to virulence regulation is limited .

  • Industrial Relevance: Potential applications in biofilm disruption or food safety interventions require further validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ftsK; lmo1386; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-757
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
ftsK
Target Protein Sequence
MATQKKKTSGRKKSSTRSKKKQSASFRLEITGVILIAIGVIGLLQLGFVGRGFFALAEMF VGLLSYVLLAGSVILGGYMVIRRKMPHLFSKRLVGIYLIVLGFLTYIHMYFIIHNLGANA SVVSSTWKLVLENLFRPNQVGFVGGGMIGAAITSITYFLLDRLGTNLIAVLLIIYGFSLV SGISIRQFFSKIAEFVRYLFTKGKVATEKGKEVKAKRDKKKAEKIVDVEPDEVIDVIEPL QEEKTPPIISNFSSKVEQEKAPVEEKISQKEQDLEMFQQESFENEIYQLPPVDILAPAKV TDQSKEYDQIKVNAKKLEDTFESFGVKAKITQVHLGPAVTKYEVQPSVGVKVSKIVSLSD DIALALAAKDIRIEAPIPGKSAIGIEVANQNVAMVSLREVLENNPKNNPDEKLQIALGRD ISGEAMMANLDKMPHLLVAGATGSGKSVCINGIITSILLRAKPHEVKMMMIDPKMVELNV YNGIPHLLAPVVTNPKKAAQALQKVVAEMERRYDLFSHTGTRNMQGYNDYVKKHNELNEE KQPELPFIVVIVDELADLMMVASNDVEDAITRLAQMARAAGIHLIIATQRPSVDVITGVI KANIPSRIAFAVSSSIDSRTILDMGGAEKLLGRGDMLLLPVGSSKPTRIQGAFLSDAEVE DVVNYVISQQKAQYSEEMIPDDIPEVEGEVTDELYHEAVELVVEMQTASVSMLQRKFRIG YNRAARLIDEMEQRGVVGPHEGSKPRRVNVEVSPEHE
Uniprot No.

Target Background

Function
FtsK, an essential cell division protein, plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in assembling the cell-division machinery, while the C-terminus functions as a DNA motor. This motor moves double-stranded DNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. FtsK is essential for activating the Xer recombinase, which enables chromosome unlinking through recombination.
Database Links

KEGG: lmo:lmo1386

STRING: 169963.lmo1386

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does recombinant L. monocytogenes FtsK differ from native protein in terms of structure and activity?

Recombinant L. monocytogenes FtsK is typically expressed with specific tags for purification and detection purposes. The recombinant protein maintains the core functional domains of native FtsK but may include:

  • Affinity tags (determined during production process)

  • Modified terminal regions

  • Storage in optimized buffer conditions (Tris-based buffer with 50% glycerol)

These modifications generally preserve the primary structure and function while enabling laboratory manipulation. Activity comparisons between native and recombinant forms should be experimentally validated in each research context, with particular attention to:

  • DNA binding affinity

  • ATPase activity

  • DNA translocation rates

  • Interactions with other cell division proteins

What are the optimal storage and handling conditions for recombinant L. monocytogenes FtsK protein?

For optimal stability and activity, recombinant L. monocytogenes FtsK should be stored according to these guidelines:

Storage ConditionRecommendationPurpose
Long-term storage-20°C or -80°CPrevents protein degradation
Working aliquots4°C for up to one weekMinimizes freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerolMaintains protein stability
Freeze-thaw cyclesAvoid repeated freezing and thawingPrevents denaturation

The protein is typically supplied at a concentration suitable for most experimental applications (from 50 μg), and additional quantities may be available for larger-scale experiments .

What experimental approaches are most effective for studying FtsK activity in chromosome segregation?

To study FtsK activity in chromosome segregation, researchers should consider these methodological approaches:

  • In vitro DNA translocation assays:

    • Using purified recombinant FtsK and fluorescently labeled DNA substrates

    • Measuring ATP-dependent DNA movement using single-molecule techniques

  • Coevolution experiments:

    • Monitoring genetic variations that emerge under selective pressure

    • Analyzing both phage and bacterial host adaptations during reciprocal selection

  • Comparative genomic analysis:

    • Contrasting FtsK functions across bacterial species (e.g., comparing with SpoIIIE in B. subtilis)

    • Identifying conserved domains and species-specific adaptations

  • Live-cell imaging:

    • Tracking fluorescently tagged FtsK localization during cell division

    • Correlating FtsK positioning with chromosome segregation events

These approaches can be complementary, providing a comprehensive understanding of FtsK's role in chromosome dynamics.

How does L. monocytogenes FtsK contribute to bacterial pathogenesis and virulence?

L. monocytogenes FtsK's contribution to pathogenesis extends beyond its primary role in chromosome segregation:

  • Cell division and persistence:

    • FtsK ensures faithful chromosome partitioning, maintaining bacterial fitness during infection

    • Proper chromosome segregation supports the persistent colonization of food processing facilities for years

  • Potential interaction with virulence factors:

    • While direct evidence is limited, FtsK may influence expression or function of virulence factors

    • Cell division defects can trigger stress responses that modify virulence gene expression

  • Role in biofilm formation:

    • Biofilms contribute to L. monocytogenes persistence in food processing environments

    • FtsK-mediated chromosome segregation ensures genomic integrity during biofilm development

  • Response to environmental stressors:

    • FtsK function may be modulated during exposure to food preservation methods

    • Adaptations in FtsK could contribute to survival under antimicrobial treatments

These pathogenesis-related functions make FtsK and its recombinant versions important targets for food safety and infection control research.

What is the role of FtsK in phage resistance and coevolution dynamics?

FtsK plays a complex role in phage-host interactions and coevolution dynamics:

  • DNA metabolism during phage infection:

    • FtsK-mediated DNA translocation may influence phage DNA packaging or replication

    • Mutations in FtsK could alter susceptibility to phage infection

  • Coevolution experiments reveal:

    • L. monocytogenes develops phage resistance through various genetic mechanisms

    • Phages adapt to overcome resistance through mutations and recombination events

    • These dynamics can inform development of more effective phage-based biocontrol strategies

  • Evolutionary implications:

    • Phage pressure may drive FtsK sequence diversity across L. monocytogenes strains

    • FtsK variants could influence horizontal gene transfer rates, affecting bacterial evolution

Research shows that in vitro evolution of phages can expand host range and improve long-term efficacy of phage-based control of L. monocytogenes, with potential applications in biocontrol, detection, and phage therapy .

How does L. monocytogenes FtsK compare to homologous proteins in other bacterial species?

L. monocytogenes FtsK belongs to a conserved family of bacterial translocases with homologs across diverse bacterial species. Key comparative insights include:

SpeciesHomologous ProteinFunctional SimilaritiesKey Differences
E. coliFtsKChromosome segregation, dimer resolutionDifferent regulatory mechanisms
B. subtilisSftA (YtpS)Colocalizes with FtsZ, stimulates chromosome dimer resolutionCannot rescue trapped chromosomes
B. subtilisSpoIIIEDNA translocation across membranesFunctions primarily in sporulation

Unlike E. coli, which has one FtsK protein, B. subtilis contains two distinct FtsK/SpoIIIE-like proteins with specialized functions. SftA plays a role similar to E. coli FtsK during each cell cycle, while SpoIIIE functions in post-septational DNA translocation, especially during sporulation .

The presence of two FtsK/SpoIIIE paralogs is not conserved among all endospore-forming bacteria but is highly conserved within several groups of soil- and plant-associated bacteria .

What evolutionary insights can be gained from studying the genetic diversity of FtsK across L. monocytogenes strains?

Studying FtsK diversity across L. monocytogenes strains reveals important evolutionary insights:

This evolutionary perspective provides context for understanding strain-specific variations in pathogenicity and environmental persistence.

How can recombinant L. monocytogenes FtsK be utilized in vaccine development?

Recombinant L. monocytogenes FtsK offers several potential applications in vaccine development:

  • Vector for antigen delivery:

    • L. monocytogenes serves as an effective vaccine vector due to its ability to stimulate robust cellular immune responses

    • Recombinant L. monocytogenes can be engineered to secrete bacterial antigens and tumor antigens

  • PEST sequence utilization:

    • PEST sequences (found in proteins with short cellular half-life) can be incorporated into recombinant L. monocytogenes vaccines

    • These sequences target proteins for degradation in the ubiquitin-proteasome pathway, enhancing immunogenicity

  • Enhanced antigen processing:

    • FtsK or its domains might be fused to target antigens to improve processing and presentation

    • This approach could potentially enhance CD8+ T cell responses against target antigens

  • Experimental findings:

    • Studies show that Listeria expressing fusion proteins containing PEST sequences effectively regress established tumors in mouse models

    • Strong correlation exists between CD8+ T cell induction, tumor homing, and antitumor efficacy of the Listeria-based vaccines

These applications highlight the potential of recombinant L. monocytogenes FtsK in both infectious disease and cancer immunotherapy development.

What are the challenges and solutions in producing high-quality recombinant L. monocytogenes FtsK for research applications?

Production of high-quality recombinant L. monocytogenes FtsK presents several challenges that researchers must address:

ChallengeImpactSolution
Protein solubilityPoor yield, aggregationOptimize expression conditions; use solubility tags
Full-length expressionTruncated productsCodon optimization; expression in specialized strains
Functional activityLoss of DNA binding/ATPase activityPreserve native structure; avoid tag interference with functional domains
ContaminationEndotoxin or nucleic acid contaminationMultiple purification steps; quality control testing
StabilityDegradation during storageOptimize buffer composition; aliquot and store at -80°C

Quality control measures should include:

  • Verification of protein purity by SDS-PAGE and Western blotting

  • Assessment of DNA-binding activity through electrophoretic mobility shift assays

  • Evaluation of ATPase activity using colorimetric phosphate release assays

  • Testing for endotoxin contamination, especially for immunological applications

When stored properly in Tris-based buffer with 50% glycerol at -20°C or -80°C, high-quality recombinant protein can maintain activity for extended periods .

What are common pitfalls in FtsK functional assays and how can they be addressed?

When conducting functional assays with recombinant L. monocytogenes FtsK, researchers frequently encounter these challenges:

  • ATP hydrolysis background levels:

    • Issue: High background ATPase activity in preparations

    • Solution: Include appropriate controls without DNA substrates; purify protein to >95% homogeneity

  • DNA substrate specificity:

    • Issue: Inconsistent translocation activity with different DNA templates

    • Solution: Use defined DNA substrates with characterized FtsK recognition sequences; test multiple template designs

  • Buffer optimization:

    • Issue: Suboptimal activity due to buffer conditions

    • Solution: Systematically test different buffer compositions, including variations in:

      • Divalent cation concentrations (Mg²⁺, Ca²⁺)

      • pH range (6.5-8.5)

      • Salt concentrations (50-200 mM)

  • Protein aggregation during assays:

    • Issue: Loss of activity due to protein aggregation

    • Solution: Include stabilizing agents (glycerol, BSA); avoid freeze-thaw cycles; centrifuge samples before use

  • Assay detection limits:

    • Issue: Insufficient sensitivity to detect translocation events

    • Solution: Employ fluorescence-based assays or single-molecule techniques with higher sensitivity

Each of these challenges can be addressed through careful experimental design and appropriate controls.

How can researchers design experiments to study FtsK's role in L. monocytogenes pathogenesis?

To effectively study FtsK's role in L. monocytogenes pathogenesis, researchers should consider these experimental approaches:

  • Genetic manipulation strategies:

    • Generate conditional mutants (as complete knockouts may be lethal)

    • Create domain-specific mutations that separate chromosome segregation from other functions

    • Employ CRISPR-Cas9 for precise genetic modifications

  • Infection models:

    • Cell culture: Human intestinal epithelial cells for invasion assays

    • Animal models: Guinea pig or mouse models of listeriosis

    • Evaluation parameters: Bacterial burden, dissemination, immune response

  • Expression analysis:

    • Measure FtsK expression levels during different infection stages

    • Compare expression in virulent vs. attenuated strains

    • Analyze regulation under infection-relevant stresses

  • Coevolution experiments:

    • Setup: L. monocytogenes cultures with phages at multiplicity of infection (MOI) of 1

    • Monitoring: OD₆₀₀ measurements for 55-60 hours

    • Sampling: Isolate bacterial survivors at 6-8 hours post-infection and during early regrowth (OD₆₀₀ 0.05-0.1)

    • Analysis: Whole-genome sequencing to identify mutations and adaptations

  • Protein-protein interaction studies:

    • Identify FtsK interaction partners during infection

    • Assess how these interactions change in different host environments

These approaches can be integrated to provide a comprehensive understanding of FtsK's multifaceted roles in L. monocytogenes pathogenesis.

What emerging technologies could advance our understanding of L. monocytogenes FtsK?

Several cutting-edge technologies show promise for deepening our understanding of L. monocytogenes FtsK:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural analysis of FtsK complexes with DNA

    • Visualization of conformational changes during ATP hydrolysis and translocation

  • Single-cell sequencing applications:

    • Analysis of FtsK expression heterogeneity within bacterial populations

    • Correlation with cell cycle stages and virulence factor expression

  • Microfluidics combined with live-cell imaging:

    • Real-time visualization of FtsK dynamics during cell division

    • Measurement of chromosome segregation kinetics under controlled conditions

  • CRISPR interference (CRISPRi):

    • Tunable repression of FtsK expression to study dosage effects

    • Temporal control of FtsK availability during infection

  • Synthetic biology approaches:

    • Creation of minimal functional FtsK variants

    • Engineering orthogonal systems to dissect individual FtsK functions

These technologies could resolve longstanding questions about FtsK mechanism and function in L. monocytogenes biology and pathogenesis.

What are the potential implications of FtsK research for developing novel antimicrobial strategies?

Research on L. monocytogenes FtsK has several promising implications for antimicrobial development:

  • FtsK as a direct drug target:

    • Essential nature makes it an attractive antibacterial target

    • ATP-binding pocket offers potential binding sites for small molecule inhibitors

    • Species-specific domains could enable selective targeting

  • Phage-based biocontrol strategies:

    • Understanding FtsK's role in phage resistance can inform improved phage cocktails

    • In vitro evolution of phages can overcome bacterial resistance mechanisms

    • Engineered phages targeting FtsK-dependent processes could enhance killing efficiency

  • Vaccine development applications:

    • Recombinant L. monocytogenes vectors expressing immunogenic epitopes

    • PEST sequence incorporation to enhance antigen processing and presentation

    • Multi-antigen constructs targeting both bacterial and tumor antigens

  • Diagnostic applications:

    • FtsK-specific detection methods for environmental or clinical samples

    • Strain-specific core genome MLST schemes including FtsK for outbreak tracking

These applications highlight how fundamental research on L. monocytogenes FtsK can translate into practical tools for addressing food safety concerns and treating listeriosis infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.