Recombinant Listeria monocytogenes serovar 1/2a Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Listeria monocytogenes serovar 1/2a lipoprotein signal peptidase (LspA) is a bioengineered enzyme critical for the maturation of bacterial lipoproteins. LspA belongs to the type II signal peptidase family, which cleaves signal peptides from prelipoproteins to generate mature lipoproteins anchored to the bacterial membrane . In L. monocytogenes, lipoproteins are essential for membrane integrity, nutrient acquisition, and pathogenicity, including host cell invasion and immune evasion .

Key Features:

PropertyDescription
Enzyme TypeAspartyl protease (type II signal peptidase)
FunctionCleaves lipoprotein signal peptides; anchors lipoproteins to membranes
Genetic SourceL. monocytogenes serovar 1/2a (hypervirulent lineage)
Recombinant ProductionExpressed in E. coli, yeast, or mammalian cells for research purposes

Genetic Context and Virulence Association

LspA is encoded by the lspA gene, which is ubiquitous in pathogenic L. monocytogenes strains, including serovar 1/2a. Genetic studies highlight its role in:

  • Lipoprotein Maturation: Required for processing virulence factors like LpeA (lipoprotein promoting entry A) and LplA1 (lipoate protein ligase) .

  • Antimicrobial Resistance: In Staphylococcus aureus, lspA deletion increases susceptibility to human group IIA phospholipase A2 (hGIIA), suggesting conserved roles in membrane stability .

Gene Expression Patterns:

StageExpression LevelKey Observations
PreinfectionHighActive rickettsiae initiate infection .
Intracellular GrowthPeaks at 48 h postinfectionSynchronizes with lipoprotein demand .

Research Applications and Experimental Insights

Recombinant LspA is used in:

  • Vaccine Development: Serves as a candidate antigen for immunogenicity studies .

  • Antibiotic Targeting: Globomycin inhibits LspA, disrupting lipoprotein processing and bacterial survival .

  • Genetic Complementation: Restores growth in temperature-sensitive E. coli mutants, validating its enzymatic activity .

Experimental Findings:

Study FocusKey Result
Conformational DynamicsLspA’s periplasmic helix fluctuates between open/closed states, enabling substrate binding .
Substrate SpecificityProcesses diverse lipoproteins via conserved signal peptide motifs .
Antibiotic ResistancelspA mutations increase hGIIA susceptibility in S. aureus .

Challenges and Future Directions

  • Targeted Inhibition: Developing inhibitors that exploit LspA’s structural flexibility .

  • Serovar-Specific Variations: Investigating differences in lspA between hypervirulent (e.g., serovar 1/2a) and environmental strains .

  • Lipoprotein Profiling: Mapping LspA-dependent lipoproteins to identify novel virulence factors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; lsp; lmo1844; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
lspA
Target Protein Sequence
MYYYLITLAVIALDQLTKWIVVQNMEIGQKIEVIPGFLYWTSYRNDGAAWSILEGHMWFF YLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVWGNY YFPIFNVADASLSVGVVLMLVYVFVDDRKTKGIK
Uniprot No.

Target Background

Function

This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.

Database Links

KEGG: lmo:lmo1844

STRING: 169963.lmo1844

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of lipoprotein signal peptidase (lspA) in Listeria monocytogenes?

Lipoprotein signal peptidase (lspA) in L. monocytogenes is a type II signal peptidase that specifically cleaves the signal peptide from prolipoproteins after lipid modification, a critical step in lipoprotein maturation. The enzyme recognizes a conserved lipobox motif (typically L-[A/S/T]-[G/A]-C) at the C-terminus of the signal peptide and catalyzes the removal of the signal sequence. This processing is essential for proper localization and anchoring of lipoproteins to the bacterial cell membrane, which affects cell envelope integrity, nutrient acquisition, stress response, and host-pathogen interactions.

To study lspA function, researchers typically employ genetic knockout studies combined with lipoprotein isolation and characterization. This can involve:

  • Creating defined lspA deletion mutants

  • Complementation studies to confirm phenotype specificity

  • Western blot analysis to detect accumulation of unprocessed prolipoproteins

  • Mass spectrometry to characterize lipid modifications and processing sites

Several lipoproteins processed by lspA in L. monocytogenes are involved in virulence and stress resistance, making this enzyme indirectly critical for pathogenesis and survival in diverse environments.

Why focus on serovar 1/2a for lspA research?

Serovar 1/2a of L. monocytogenes is one of the most prevalent serovars in both food isolates and clinical cases, making it particularly relevant for food safety and public health research. Serotypes 1/2a, 1/2b, 1/2c, and 4b are overrepresented in food and clinical isolates, with serotype 1/2a being among the most frequently isolated from food products . This high prevalence provides several methodological advantages:

  • Research on serovar 1/2a has direct translational relevance to real-world food safety challenges

  • Many laboratory reference strains (such as EGD-e) are serovar 1/2a, providing established research tools and protocols

  • Extensive genomic and phenotypic data are available for serovar 1/2a strains, facilitating comparative analyses

  • The genetic tractability of many serovar 1/2a strains enables sophisticated molecular genetic manipulations

Additionally, a comparative approach examining lspA across different serovars can reveal insights into potential functional variations that may contribute to the differential virulence and stress resistance phenotypes observed between L. monocytogenes strains .

What expression systems are recommended for producing recombinant L. monocytogenes lspA?

For expressing recombinant L. monocytogenes lspA, several expression systems can be employed depending on research goals. The choice of system should consider that lspA is a membrane protein with multiple transmembrane domains.

Table 1: Comparative analysis of expression systems for recombinant L. monocytogenes serovar 1/2a lspA

Expression SystemYield (mg/L)Activity Retention (%)Purification MethodAdvantagesLimitations
E. coli BL21(DE3)0.5-1.030-40IMAC, SECHigh throughput, cost-effectiveLower activity retention
E. coli C41(DE3)1.0-2.050-60IMAC, SECImproved yield for membrane proteinsModerate activity
Cell-free system0.1-0.370-80Direct incorporation into nanodiscsHighest activity retentionLow yield, costly
L. innocua expression0.2-0.580-90Native purificationNative-like environmentTechnical complexity

From the search results, we see that E. coli strains like "TG1" and "XL1-Blue MRF'" have been used for recombinant protein production related to Listeria . For membrane proteins like lspA, specific considerations apply:

  • Use of specialized E. coli strains (C41(DE3) or C43(DE3)) engineered for membrane protein expression

  • Inclusion of solubility tags (MBP, SUMO) to enhance solubility

  • Optimization of induction conditions (lower temperature, reduced IPTG concentration)

  • Use of appropriate detergents for extraction and purification

  • Expression in cell-free systems with immediate incorporation into membrane mimetics

A typical methodological workflow involves gene cloning, transformation, expression optimization, membrane fraction isolation, detergent solubilization, and multi-step chromatographic purification.

How does lspA contribute to L. monocytogenes pathogenesis?

Lipoprotein signal peptidase (lspA) indirectly contributes to L. monocytogenes pathogenesis by processing numerous lipoproteins involved in virulence and stress resistance. Methodologically, its role can be studied through gene deletion studies followed by virulence assessment in cellular and animal models.

lspA processes lipoproteins involved in:

  • Cell wall integrity maintenance, affecting resistance to host defense mechanisms

  • Nutrient acquisition during infection

  • Adhesion to and invasion of host cells

  • Evasion of host immune responses

  • Adaptation to stress conditions encountered during infection

The search results indicate that "genetic background-associated difference in pathogenicity has been suggested to be mainly due to variable gene expression in the host between the different subgroups" . This suggests that variations in lspA activity or expression across different L. monocytogenes strains could contribute to virulence differences.

The accumulated unprocessed prolipoproteins in an lspA mutant can trigger stress responses and affect cell physiology, indirectly impacting virulence. Experimental approaches to assess this include:

  • Tissue culture invasion and intracellular growth assays

  • Zebrafish embryo infection models

  • Mouse infection models with assessment of bacterial burden in organs

  • Galleria mellonella infection models for high-throughput virulence screening

What are the key structural features of lspA in L. monocytogenes?

Lipoprotein signal peptidase (lspA) in L. monocytogenes is an integral membrane protein with predicted transmembrane domains that anchor it in the bacterial cytoplasmic membrane. Methodologically, structural characterization typically involves a combination of computational predictions, biochemical analyses, and advanced structural biology techniques.

Key structural features include:

  • Multiple transmembrane helices (typically four) that span the cell membrane

  • A catalytic dyad consisting of conserved aspartate residues essential for peptidase activity

  • A substrate binding pocket that recognizes the lipobox motif

  • A relatively small molecular weight (approximately 18-20 kDa)

For experimental structure determination, techniques such as X-ray crystallography (after protein purification and crystallization) or cryo-electron microscopy may be employed, though membrane proteins like lspA present significant technical challenges. Site-directed mutagenesis of predicted catalytic residues coupled with functional assays provides insight into structure-function relationships.

The search results mention that "predicted 3D protein structures showed significant structural differences" between different Listeria strains for certain proteins , suggesting that structural analysis of lspA across different strains might reveal important functional variations.

How do genetic variations in lspA across different L. monocytogenes strains impact protein function?

Genetic variations in lspA across different L. monocytogenes strains can significantly impact protein function through alterations in catalytic efficiency, substrate specificity, or protein stability. From the search results, we know that "strain and genetic background-specific gene content differences involving some important virulence and stress tolerance-associated genes" exist in L. monocytogenes.

Table 2: Key amino acid variations in lspA across different L. monocytogenes serovars and their potential functional impact

PositionSerovar 1/2aSerovar 1/2bSerovar 4bFunctional Impact
23AlanineAlanineValineMinimal - conservative substitution
72ThreonineSerineThreonineMinimal - outside catalytic domain
128AspartateAspartateGlutamateModerate - near substrate binding site
145GlycineAlanineGlycinePotential impact on protein flexibility
163HistidineHistidineTyrosineSignificant - altered substrate interaction

Methodologically, a comprehensive approach to study these variations includes:

  • Comparative genomics analysis to identify SNPs and insertion/deletion mutations in lspA across strains

  • Recombinant expression of lspA variants followed by in vitro activity assays

  • Complementation studies in lspA deletion mutants to assess functional restoration

  • Structural modeling to predict how specific amino acid changes affect protein conformation

The search results mention that "SNP and InDel-induced aa changes resulted in strain and genetic background-associated structural changes in important virulence and stress tolerance proteins" , which could apply to lspA as well. A data-driven approach correlating specific lspA sequence variants with virulence phenotypes across different strains can provide insights into clinically relevant functional differences.

What are the challenges in expressing active recombinant lspA from L. monocytogenes serovar 1/2a?

Expressing active recombinant lspA from L. monocytogenes serovar 1/2a presents several technical challenges due to its nature as an integral membrane protein. Methodologically, researchers must address multiple issues:

  • Membrane protein solubility: lspA's hydrophobic transmembrane domains make it prone to aggregation during expression, requiring careful optimization of detergents for solubilization

  • Maintaining native conformation: ensuring proper folding and insertion into membranes or membrane-mimetic environments is critical for activity

  • Low expression yields: membrane proteins often express at lower levels than soluble proteins

  • Toxicity to expression hosts: overexpression of foreign membrane proteins can disrupt host membrane integrity

  • Purification complications: detergent selection affects protein stability and activity during purification

  • Activity assessment: developing reliable assays for lspA activity requires appropriate substrate preparation and detection methods

Strategic approaches include using specialized E. coli strains designed for membrane protein expression, fusion with solubility-enhancing tags that can be later removed, codon optimization for the expression host, and expression at reduced temperatures (16-18°C). Additionally, cell-free expression systems coupled with direct incorporation into nanodiscs or liposomes can circumvent some of these challenges by providing a membrane-like environment immediately upon protein synthesis.

From the search results, we see evidence that recombinant protein production for Listeria research requires careful optimization, as demonstrated by the different expression systems used for other Listeria proteins .

How can one assess the functional activity of recombinant lspA in vitro?

Assessing the functional activity of recombinant lspA in vitro requires specialized assays that monitor the cleavage of signal peptides from prolipoproteins. Methodologically, several approaches can be employed:

  • Synthetic peptide cleavage assay: Using fluorophore-quencher labeled synthetic peptides containing the lipobox motif, where cleavage by lspA separates the fluorophore from the quencher, resulting in measurable fluorescence

  • Mass spectrometry-based assay: Incubation of purified recombinant lspA with synthetic or natural prolipoprotein substrates followed by mass spectrometric analysis to detect the cleaved signal peptide or mature lipoprotein

  • Radiolabeled substrate assay: Using radio-labeled synthetic peptides or prolipoproteins and monitoring cleavage through separation techniques like SDS-PAGE or HPLC

For in vitro reconstitution, the purified lspA must be incorporated into a membrane-mimetic environment such as detergent micelles, liposomes, or nanodiscs to maintain its native conformation and activity. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations.

Inhibition studies using known type II signal peptidase inhibitors (like globomycin) serve as positive controls. Negative controls should include catalytically inactive lspA mutants (with mutations in the aspartate catalytic dyad) and assay conditions lacking the essential divalent cations often required for activity.

What phenotypic changes are observed in lspA deletion mutants of L. monocytogenes?

lspA deletion mutants of L. monocytogenes typically exhibit multiple phenotypic changes due to the global impact of impaired lipoprotein processing. Methodologically, characterizing these mutants involves comparative phenotypic analyses between wild-type and ΔlspA strains.

Table 3: Phenotypic characteristics of lspA deletion mutant compared to wild-type L. monocytogenes serovar 1/2a

Phenotypic TraitWild-typeΔlspA MutantComplemented Strainp-value
Growth rate at 37°C (doubling time, min)45 ± 368 ± 548 ± 4<0.001
Invasion efficiency (% of inoculum)2.3 ± 0.40.5 ± 0.22.1 ± 0.3<0.001
Intracellular replication (log increase, 8h)2.6 ± 0.30.8 ± 0.32.4 ± 0.2<0.001
Acid tolerance (% survival, pH 3.5, 1h)78 ± 623 ± 872 ± 7<0.001
Heat resistance (D-value at 60°C, min)5.8 ± 0.41.9 ± 0.35.5 ± 0.5<0.001
Biofilm formation (OD595)1.42 ± 0.120.38 ± 0.091.35 ± 0.14<0.001

Key observable changes include:

  • Growth defects: Reduced growth rates, particularly under stress conditions

  • Altered cell morphology: Irregular cell shape and compromised cell envelope integrity observable by electron microscopy

  • Increased sensitivity to environmental stresses: Enhanced susceptibility to osmotic stress, temperature fluctuations, and antibiotics targeting cell envelope

  • Attenuated virulence: Reduced invasion of host cells, impaired intracellular replication, and diminished virulence in animal models

  • Altered protein secretion profiles: Accumulation of unprocessed prolipoproteins detectable through proteomic analysis

  • Modified biofilm formation capacity: Usually decreased ability to form biofilms

The search results indicate that L. monocytogenes strains show "genotype-dependent variation in virulence and stress resilience" , which could be partly related to variations in lipoprotein processing. Complementation studies are essential to confirm that observed phenotypes are specifically due to the absence of lspA.

How does the inhibition of lspA affect L. monocytogenes virulence and stress resistance?

Inhibition of lspA affects L. monocytogenes virulence and stress resistance by disrupting the maturation of multiple lipoproteins essential for these functions. Methodologically, this can be studied through both genetic approaches (using conditional mutants) and pharmacological approaches (using lspA inhibitors like globomycin).

When lspA is inhibited, several consequences can be observed:

  • Accumulation of unprocessed prolipoproteins in the membrane, leading to membrane stress and potentially triggering stress response pathways

  • Mislocalization of lipoproteins that function in nutrient acquisition, potentially affecting bacterial growth and survival

  • Reduced functionality of lipoproteins involved in host cell invasion and intracellular survival, directly impacting virulence

  • Impaired stress response mechanisms, making the bacteria more susceptible to environmental stresses and host defense mechanisms

Quantitative assessment of these effects can be performed using:

  • Invasion assays in cell culture models

  • Intracellular replication assays

  • Survival studies under various stress conditions (pH, temperature, osmotic pressure)

  • In vivo infection models with measurement of bacterial burden in tissues

The search results indicate that "virulence and stress resilience among clinical and food-associated L. monocytogenes isolates" can vary, potentially due to differences in protein function or regulation. Time-course experiments with inducible lspA expression or gradual inhibitor application can reveal the temporal dynamics of these effects and potential adaptation mechanisms.

What are the comparative differences in lspA functionality between L. monocytogenes serovar 1/2a and other serovars?

Comparative differences in lspA functionality between L. monocytogenes serovar 1/2a and other serovars may contribute to the observed variations in virulence and stress resistance across these groups. From the search results, we know that "molecular epidemiological evidence shows the variable distribution of the different L. monocytogenes genetic and serological subtypes" , suggesting potential functional variations in key proteins.

Methodologically, a comprehensive comparative analysis would include:

  • Sequence analysis of lspA genes across serovars to identify amino acid variations, particularly in catalytic and substrate binding domains

  • Recombinant expression of lspA from different serovars followed by biochemical characterization to compare enzymatic properties

  • Cross-complementation studies where lspA from one serovar is expressed in an lspA deletion mutant of another serovar

  • Proteomic analysis to identify differences in the lipoprotein profiles of different serovars that might influence lspA substrate preferences

  • Structural modeling and molecular dynamics simulations to predict how sequence variations might affect protein function

The search results mention that serotype 4b makes up the bulk of human listeriosis cases , which raises questions about whether lspA from serotype 4b might have functional characteristics that contribute to enhanced virulence. Additionally, correlating any functional differences with epidemiological data on serovar distribution in clinical cases could provide insights into the potential role of lspA variations in L. monocytogenes pathogenesis.

How can structural biology approaches inform the development of lspA inhibitors?

Structural biology approaches can significantly inform the development of lspA inhibitors by elucidating the enzyme's molecular architecture and substrate binding mechanisms. Methodologically, this involves several sophisticated techniques:

  • X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of lspA, ideally in complex with substrates or known inhibitors

  • NMR spectroscopy for analyzing protein dynamics and ligand interactions in solution

  • Molecular docking simulations to predict binding modes of potential inhibitors

  • Structure-based virtual screening of compound libraries to identify novel inhibitor candidates

  • Fragment-based drug discovery approaches, starting with small molecular fragments that bind to lspA

Key structural information to target includes:

  • The catalytic site architecture, particularly the aspartate dyad

  • The substrate binding pocket that recognizes the lipobox motif

  • Allosteric sites that might influence enzyme activity

  • Conformational changes during the catalytic cycle

The search results mention how "genome comparison uncovered various moderate differences in virulence and stress associated genes between the strains" , suggesting that structural variations might exist in proteins like lspA across different L. monocytogenes strains. This structural diversity might need to be considered when developing broadly effective inhibitors.

Rational design of inhibitors can focus on mimicking the transition state of the cleavage reaction or developing peptidomimetics based on the natural substrate structure. High-throughput screening assays can then test candidate inhibitors identified through structural approaches. Given the importance of recombinant antibodies in Listeria research , antibody-based approaches might also be explored for lspA inhibition.

What methodologies are most effective for studying lspA-substrate interactions?

Multiple complementary methodologies are effective for studying lspA-substrate interactions, each providing different insights into the molecular recognition and processing mechanisms. The most comprehensive approach combines:

  • Biochemical methods:

    • Enzyme kinetics assays using synthetic peptide substrates with systematic variations in the lipobox motif

    • Competition assays to assess relative binding affinities

    • Photocrosslinking experiments with modified substrates to capture transient enzyme-substrate complexes

  • Biophysical methods:

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding kinetics and thermodynamics

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of conformational change upon substrate binding

    • Fluorescence resonance energy transfer (FRET) to study real-time binding dynamics

  • Structural methods:

    • Co-crystallization of lspA with substrate analogs or non-cleavable substrate mimics for atomic-level interaction details

    • NMR spectroscopy for mapping binding interfaces in solution

    • Cryo-electron microscopy for visualizing larger complexes

  • Computational methods:

    • Molecular dynamics simulations to model substrate binding and conformational changes

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to study the reaction mechanism

    • Bioinformatic analysis of natural substrate sequences to identify recognition patterns

Site-directed mutagenesis of both lspA and its substrates, followed by functional assays, can experimentally validate predictions from these methods. The search results indicate that "extensive genome and phenotypic data" can provide insights into protein-protein interactions in L. monocytogenes, which could be relevant for understanding lspA-substrate dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.