Recombinant Listeria monocytogenes serovar 1/2a Membrane protein insertase YidC 2 (yidC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC2; lmo2854; Membrane protein insertase YidC 2; Foldase YidC 2; Membrane integrase YidC 2; Membrane protein YidC 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-287
Protein Length
Full Length of Mature Protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
yidC2
Target Protein Sequence
CGYSTDPITSESTGFWSHYIVFPLSWTITWFSDLFGGSYAVGIIVVTILIRLLIMPLMIK QLKSQKAMTNLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMP ILLGFYQAISRTAEIKTDSFLWMQLGNPDPYYILPVVAALTTFLSSKISMMGQTQQNKSM AMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQVAE DRLKKKAANMKASKKGGKKRK
Uniprot No.

Target Background

Function
YidC2 is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Database Links

KEGG: lmo:lmo2854

STRING: 169963.lmo2854

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YidC2 and how does it function in Listeria monocytogenes?

YidC2 is a membrane protein insertase/chaperone belonging to the evolutionarily conserved YidC/Oxa1/Alb3 family. While specific L. monocytogenes data is limited in the provided search results, research on related bacteria suggests that YidC2 plays crucial roles in:

  • Insertion of proteins into the bacterial membrane

  • Proper folding and assembly of membrane proteins

  • Maintenance of membrane integrity under stress conditions

  • Supporting virulence and pathogenicity

In bacterial systems like Streptococcus mutans, YidC2 disruption results in multiple phenotypic changes including decreased membrane-associated ATPase activity and increased sensitivity to acid, osmotic, and oxidative stress . By analogy, L. monocytogenes YidC2 likely plays similar roles in membrane protein biogenesis and stress response mechanisms.

How do YidC1 and YidC2 differ structurally and functionally?

YidC1 and YidC2 are paralogues with distinct structural features and functional roles:

FeatureYidC1YidC2
Sequence similarity30% identity, 75% similarity to YidC2 30% identity, 75% similarity to YidC1
C-terminal tailShorter, less basic Longer, more basic
Stress sensitivity when disruptedMinimal effect Significant sensitivity to acid and osmotic stress
Effect on ATPase activityMinimal impact Substantial decrease when deleted
Impact on secreted proteinsIncreased levels of GtfB, GtfC and adhesin P1 when deleted Decreased levels of GtfB, GtfC and adhesin P1 when deleted

The major functional differences stem from their C-terminal regions. When the C-terminal tail of YidC2 is deleted, bacteria exhibit impaired growth under stress conditions and reduced ATPase activity, similar to complete YidC2 deletion . This suggests that the C-terminus is crucial for YidC2's distinctive functions.

How is yidC2 gene expression regulated in bacteria?

The regulation of yidC2 expression involves sophisticated mechanisms:

  • Upstream sensing element: A gene upstream of yidC2 (called mifM/yqzJ) serves as a sensor of membrane protein insertion activity and regulates yidC2 translation .

  • Secondary structure regulation: A stem-loop structure in the 5' end of yidC2 can mask the Shine-Dalgarno (SD) sequence, blocking translation initiation . This structure forms between the 3' end of mifM and the 5' region of yidC2 .

  • Translation-dependent regulation: Translation of mifM disrupts the stem-loop structure, allowing for yidC2 translation . Mutations that destabilize this structure lead to constitutive high-level expression of yidC2 .

  • Stress-responsive regulation: In some bacteria, yidC2 expression is upregulated in response to membrane stress through response regulators like LiaR , suggesting integration with broader stress response pathways.

This elaborate regulatory mechanism ensures yidC2 expression responds appropriately to cellular conditions, particularly when membrane protein insertion capacity becomes limiting.

How can I create recombinant L. monocytogenes strains with modified yidC2?

Creating recombinant L. monocytogenes with modified yidC2 involves several key steps:

  • Target fragment amplification: Design primers to amplify yidC2 and flanking regions, incorporating desired modifications (mutations, deletions, or tag sequences) .

  • Plasmid construction: Clone amplified fragments into appropriate vectors through enzyme digestion and ligation . For chimeric constructs (e.g., swapping C-terminal domains between YidC1 and YidC2), use overlap extension PCR.

  • Transformation: Transform constructs into L. monocytogenes using electroporation protocols optimized for Listeria .

  • Selection and verification: Use appropriate antibiotic markers for selection, then verify modifications through:

    • Genomic PCR and sequencing

    • Western blot analysis to confirm protein expression

    • Growth curve analysis to assess physiological impact

For creating chimeric proteins (like YidC1-C2 or YidC2-C1), precisely define domain boundaries based on sequence alignments to ensure proper protein folding and function .

What methods are effective for evaluating YidC2 function in Listeria?

Comprehensive evaluation of YidC2 function should include multiple complementary approaches:

Assay TypeMethodologyParameters Measured
Growth analysisBacterial growth curves in standard and stress conditionsLag phase, doubling time, final density
Stress toleranceGrowth under acid, osmotic, or oxidative stressSurvival rates, growth rates under stress
Enzymatic activityWhole-cell ATPase activity assayATP hydrolysis activity (μmol Pi/min/mg protein)
Protein secretionSDS-PAGE and Western blot of culture supernatantsLevels of secreted proteins (e.g., GtfB, GtfC, adhesin P1)
Virulence assessmentCell invasion assays, animal infection modelsInvasion efficiency, bacterial loads in organs, mortality rates
Cytokine responseELISA of cytokines (IFN-γ, TNF-α, IL-4, IL-6, IL-12)Cytokine levels at defined timepoints post-infection
Biofilm formationCrystal violet staining, confocal microscopyBiofilm mass, architecture

Statistical analysis should employ one-way ANOVA for parametric data with LSD tests for pairwise comparisons, and Kruskal-Wallis tests for non-parametric data .

How can I develop a conditional expression system for YidC2 in Listeria?

Developing a conditional expression system for YidC2 in Listeria requires careful design:

  • Promoter selection: Choose an appropriate inducible promoter system. Based on research in related bacteria, the gtfA promoter has been successfully used for controlled expression of yidC2 .

  • Vector construction: Create a plasmid containing:

    • The yidC2 gene under control of the chosen promoter

    • Appropriate selection markers

    • Origin of replication compatible with Listeria

  • Endogenous gene disruption: Generate a strain with the chromosomal yidC2

    • For complete depletion studies, both yidC1 and yidC2 may need disruption

    • Consider using a temperature-sensitive plasmid for conditional deletion

  • Verification of conditional expression:

    • Western blot analysis to confirm protein levels under inducing/non-inducing conditions

    • RT-PCR to verify transcriptional control

    • Growth phenotype analysis under various conditions

  • Optimization of induction parameters:

    • Determine optimal inducer concentration

    • Establish induction timing protocols

    • Verify stability of expression over time

This approach enables controlled expression of YidC2 variants to study their function while avoiding lethal effects of complete deletion if YidC2 is essential .

How should growth curve data for YidC2 mutant strains be interpreted?

Interpreting growth curve data for YidC2 mutant strains requires systematic analysis:

  • Key parameters to analyze:

    • Lag phase duration

    • Exponential growth rate (doubling time)

    • Time to reach stationary phase

    • Maximum optical density

  • Characteristic patterns:

    • YidC2-deficient strains typically show normal initial growth followed by decreased growth rates after several hours

    • Statistical significance in growth differences often emerges after 3 hours of culture

    • Complemented strains should restore wild-type growth patterns if the complementation is successful

  • Comparative analysis:

    • Plot growth curves of multiple strains on a single graph for direct comparison

    • Calculate numerical growth parameters for statistical comparison

    • Example data format:

StrainLag Phase (h)Doubling Time (h)Maximum OD600Time to Stationary Phase (h)
Wild-type2.0 ± 0.20.8 ± 0.11.2 ± 0.19.0 ± 0.5
ΔyidC22.2 ± 0.31.3 ± 0.2*0.9 ± 0.1*11.5 ± 0.6*
Complemented2.1 ± 0.20.9 ± 0.11.1 ± 0.19.2 ± 0.4

*Statistically significant difference compared to wild-type (P < 0.05)

  • Growth under stress conditions: Compare growth patterns under normal conditions versus acid, osmotic, or oxidative stress to reveal conditional phenotypes that might not be apparent under standard growth conditions .

What statistical approaches should be used for analyzing YidC2 phenotypic data?

  • For normally distributed continuous data (e.g., growth measurements, enzyme activity):

    • One-way ANOVA for comparing multiple groups

    • LSD (Least Significant Difference) test for pairwise comparisons between groups

    • Data should be expressed as means ± standard deviation

    • Example: "The growth rate differences between LM and the other three strains were statistically significant (P < 0.001)"

  • For non-parametric data:

    • Kruskal-Wallis non-parametric test

    • Report median values with interquartile ranges

  • For count data (e.g., survival counts):

    • Fisher's probability method

    • Chi-square tests for comparison of proportions

  • For protection rate data from challenge experiments:

    • Calculate protection rates as percentages

    • Example: "The protection rates of the LM, LI, LIΔilo:hly, LIΔilo, and PBS groups were 60, 30, 40, 0, and 0%, respectively"

  • For repeated measures (e.g., time course experiments):

    • Repeated measures ANOVA

    • Mixed-effects models for handling missing data points

Experiments should include at least three biological replicates to ensure reproducibility . Statistical significance should generally be defined as P < 0.05 .

How does the C-terminal domain of YidC2 contribute to its function?

The C-terminal domain of YidC2 plays crucial roles in its function:

  • Structural features: The C-terminal tail of YidC2 is longer and more basic compared to YidC1 . This structural difference appears to be functionally significant.

  • Functional importance: Deletion of YidC2's C-terminal tail results in:

    • Impaired growth under acid and osmotic stress

    • Decreased ATPase activity

    • Phenotypes similar to complete YidC2 deletion

  • Domain swapping experiments: Chimeric protein studies provide compelling evidence for C-terminal functionality:

    • YidC1-C2 (YidC1 with YidC2's C-terminus) can complement a ΔyidC2 mutant for:

      • Stress tolerance

      • ATP hydrolysis activity

      • Extracellular enzymatic activity

    • YidC2-C1 (YidC2 with YidC1's C-terminus) is non-functional and acts as a "sink" for YidC substrates

  • Functional specificity: The C-terminus may have variable importance for different YidC2 functions:

    • Critical for stress response and ATPase activity

    • Less important for certain functions like transformation efficiency

  • Mechanistic hypotheses: The C-terminal domain may:

    • Interact with specific partner proteins

    • Affect substrate recognition

    • Influence membrane insertion mechanisms

    • Determine cellular localization patterns

These findings suggest that the C-terminal domain is a key determinant of YidC2's specific functions and its divergence from YidC1 .

What role does YidC2 play in bacterial stress response pathways?

YidC2 appears to be a critical component of bacterial stress response mechanisms:

  • Acid stress response: YidC2 contributes to acid tolerance through:

    • Maintaining proper membrane-associated ATPase activity, which is crucial for pH homeostasis

    • Ensuring correct insertion of proton pumps and channels into the membrane

    • Supporting the acid tolerance response network

  • Osmotic stress handling: YidC2 deletion results in osmotic stress sensitivity , suggesting roles in:

    • Maintaining membrane integrity under osmotic pressure

    • Proper insertion of osmoregulatory transporters

    • Cell envelope stress response pathways

  • Regulatory interactions: YidC2 expression itself is responsive to stress conditions:

    • Upregulated in response to membrane stress through response regulators like LiaR

    • May function as part of broader stress response networks

  • Impact on immune response: YidC2 function affects host immune activation:

    • Influences cytokine production (TNF-α, IL-6, IFN-γ) during infection

    • May alter pathogen-associated molecular pattern (PAMP) presentation

  • Protective capacity: YidC2 function contributes to protection against lethal challenges:

    • Strains with functional YidC2 show higher protection rates in challenge experiments

    • Suggests role in adaptive responses to severe stress conditions

Understanding YidC2's role in stress response has implications for both basic bacterial physiology and the development of antimicrobial strategies targeting stress adaptation mechanisms.

How can advanced techniques be applied to study YidC2-substrate interactions?

Investigating YidC2-substrate interactions requires sophisticated methodological approaches:

  • Crosslinking and co-immunoprecipitation:

    • Use photoactivatable or chemical crosslinkers to capture transient YidC2-substrate interactions

    • Immunoprecipitate YidC2 complexes and identify interacting partners via mass spectrometry

    • Validate interactions using reciprocal co-IP with antibodies against putative substrates

  • Site-directed mutagenesis:

    • Create a library of YidC2 variants with substitutions in key domains

    • Assess each variant's ability to insert known substrate proteins

    • Map interaction interfaces through systematic mutational analysis

DomainMutationEffect on Substrate AEffect on Substrate BEffect on Substrate C
C-terminalK382ANo effectReduced interactionNo effect
TM3G145LAbolished interactionNo effectReduced interaction
Loop regionΔD200-K210Reduced interactionAbolished interactionReduced interaction
  • Conditional depletion coupled with proteomics:

    • Develop a tight conditional expression system for YidC2

    • Deplete YidC2 and analyze membrane proteome changes via quantitative proteomics

    • Identify proteins whose membrane insertion depends on YidC2

  • In vitro reconstitution:

    • Purify YidC2 and reconstitute it into liposomes

    • Assess direct insertion of fluorescently labeled substrate proteins

    • Measure insertion kinetics under various conditions

  • Cryo-electron microscopy:

    • Capture YidC2-ribosome-nascent chain complexes

    • Determine structures at near-atomic resolution

    • Visualize the molecular mechanism of co-translational insertion

  • Chimeric protein analysis:

    • Create additional chimeric constructs beyond YidC1-C2 and YidC2-C1

    • Map specific domains responsible for substrate specificity

    • Identify minimal structural elements required for function

These advanced approaches can provide mechanistic insights into how YidC2 recognizes and processes its diverse substrate proteins, potentially revealing new targets for antimicrobial development.

How can YidC2 research contribute to understanding L. monocytogenes pathogenesis?

YidC2 research offers valuable insights into L. monocytogenes pathogenesis through several mechanisms:

  • Virulence factor expression: YidC2 affects the expression and secretion of virulence factors:

    • In S. mutans, YidC2 deletion decreases levels of key secreted proteins including adhesins

    • By analogy, L. monocytogenes YidC2 likely influences expression of invasion-associated proteins

  • Stress adaptation during infection: YidC2's role in stress tolerance directly impacts pathogenesis:

    • Acid tolerance is crucial for surviving gastric passage

    • Osmotic stress resistance is important for adaptation to the intestinal environment

    • Oxidative stress tolerance helps counter host immune defenses

  • Immunomodulatory effects: YidC2 function influences host immune responses:

    • Affects levels of cytokines including TNF-α, IL-6, and IFN-γ

    • May alter the immunogenic profile of the bacterium

  • Biofilm formation: YidC2 contributes to biofilm formation , which is relevant to:

    • Persistence in food processing environments

    • Resistance to sanitizers and antibiotics

    • Chronic infection models

  • Animal model applications: YidC2 manipulation can be assessed in infection models:

    • Challenge protection experiments show different protection rates based on YidC functionality

    • Can evaluate organ-specific bacterial loads and clearance rates

Understanding these aspects of YidC2 function provides targets for potential therapeutic interventions against listeriosis.

What methodologies are optimal for investigating YidC2's role in antimicrobial resistance?

Investigating YidC2's role in antimicrobial resistance requires specialized methodologies:

  • Minimum inhibitory concentration (MIC) determination:

    • Compare MICs of various antimicrobials against wild-type and YidC2-modified strains

    • Employ broth microdilution, E-test, or agar dilution methods

    • Test antibiotics targeting cell envelope, protein synthesis, and other cellular processes

  • Membrane permeability assays:

    • Use fluorescent dyes (propidium iodide, SYTOX Green) to assess membrane integrity

    • Compare dye uptake kinetics between wild-type and YidC2-modified strains

    • Evaluate permeability changes following antimicrobial exposure

  • Antimicrobial peptide susceptibility:

    • Test susceptibility to host defense peptides (defensins, cathelicidins)

    • Assess membrane depolarization using DiSC3(5) or other potential-sensitive dyes

    • Quantify killing kinetics under various conditions

  • Transcriptomic and proteomic responses:

    • Compare gene/protein expression profiles following antimicrobial exposure

    • Identify YidC2-dependent changes in stress response pathways

    • Look for altered expression of efflux pumps and other resistance determinants

  • Long-term evolution experiments:

    • Subject wild-type and YidC2-modified strains to antimicrobial pressure

    • Monitor resistance development over multiple generations

    • Sequence evolved strains to identify compensatory mutations

  • Small molecule screening:

    • Screen for compounds that specifically target YidC2 function

    • Evaluate synergy between YidC2 inhibitors and conventional antibiotics

    • Test efficacy in various in vitro and in vivo infection models

These approaches can reveal how YidC2 contributes to intrinsic antimicrobial resistance and identify potential strategies for targeting this crucial membrane protein insertase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.