Recombinant Listeria monocytogenes serovar 1/2a Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; lmo2680; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
kdpC
Target Protein Sequence
MKRFMQIWKPAVIGFLLLTLVCGVLYPGVVTVFAGVAFHDKANGSIIEEKLADGTTGKVG SAEIGQTFTEPEYLIGRAASDGVATNLNPTSEEQKQLVEKRIAWWHKLDPTNNRVIPMDL VTASASGVDPDISEAAAAYQVDRISRERGISTKEVKEIIAEHTSNRLLGFWGEPTVNVLQ VNLALDRLKM
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: lmo:lmo2680

STRING: 169963.lmo2680

Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biological function of kdpC in Listeria monocytogenes?

The potassium-transporting ATPase C chain (kdpC) is part of the potassium transport system in Listeria monocytogenes. This protein functions as a component of the kdp complex, which is a high-affinity K⁺ uptake system that becomes active under conditions of potassium limitation. In Listeria, as in other bacteria, the kdp system consists of four components: kdpA, kdpB, kdpC, and kdpF, which together form a functional transport complex. The kdpC subunit specifically serves as the regulatory component, playing a crucial role in stabilizing the kdpAB complex and facilitating efficient potassium transport across the bacterial membrane .

How does the structure of recombinant kdpC from Listeria monocytogenes serovar 1/2a compare to other bacterial species?

Recombinant kdpC from Listeria monocytogenes serovar 1/2a shares structural similarities with kdpC proteins from other gram-positive bacteria, particularly in terms of conserved domains responsible for ATPase interaction. Unlike some gram-negative counterparts, the Listeria kdpC protein typically contains 190 amino acid residues with specific structural elements that facilitate its integration into the bacterial membrane. The protein contains conserved motifs that are essential for its interaction with other components of the kdp system, particularly the ATPase domain of kdpB . Comparative structural analysis reveals that while the core functional domains are conserved across bacterial species, there are serovar-specific variations in certain regions that may influence substrate specificity and regulatory mechanisms.

What expression systems are most effective for producing recombinant Listeria monocytogenes proteins?

E. coli expression systems remain the most widely used for recombinant Listeria protein production due to their efficiency and scalability. For kdpC specifically, E. coli BL21(DE3) strains with pET vector systems have demonstrated high yield and proper folding when expression conditions are optimized . Similar to the approaches used for other Listeria proteins such as PLCA, expression can be enhanced by using a His-tag for purification purposes . When working with kdpC, researchers should consider the following methodological approach:

  • Select an appropriate E. coli strain (BL21, Rosetta, or Arctic Express for difficult proteins)

  • Optimize codon usage for improved expression

  • Test different induction temperatures (16-37°C) to enhance solubility

  • Use Tris-based buffers with appropriate stabilizing agents (often 50% glycerol is effective)

  • Consider fusion tags (His, GST, MBP) to facilitate purification and enhance solubility

What are the optimal conditions for expressing soluble recombinant kdpC protein?

The optimal conditions for expressing soluble recombinant kdpC protein from Listeria monocytogenes serovar 1/2a involve several key parameters that must be controlled during the expression process:

ParameterOptimal ConditionNotes
Expression hostE. coli BL21(DE3)Provides high yield with minimal proteolysis
Growth temperature18-25°C post-inductionReduces inclusion body formation
Induction OD₆₀₀0.6-0.8Optimal cell density for induction
IPTG concentration0.1-0.5 mMLower concentrations favor solubility
Post-induction time16-18 hoursExtended expression at lower temperature
Buffer compositionTris-based (pH 7.5-8.0) with 150-300 mM NaClMaintains protein stability
Stabilizing agents10% glycerol, 1 mM DTTPrevents aggregation and oxidation

Much like the PLCA protein from Listeria monocytogenes, which requires specific conditions for optimal expression, kdpC proteins benefit from expression at lower temperatures to enhance proper folding . Researchers should monitor protein solubility through small-scale test expressions before scaling up to production levels.

How can researchers effectively confirm the functional activity of recombinant kdpC protein?

Confirming the functional activity of recombinant kdpC requires multiple complementary approaches:

  • ATPase activity assay: Measure phosphate release using colorimetric assays (malachite green or molybdate-based) when kdpC is reconstituted with other components of the kdp system.

  • Potassium transport assays: Employ K⁺-selective electrodes or fluorescent probes (like PBFI) to measure potassium flux in reconstituted proteoliposomes containing the recombinant kdpC along with kdpA and kdpB.

  • Complementation studies: Express the recombinant protein in kdpC-deficient bacterial strains and assess restoration of potassium transport function under K⁺-limited conditions.

  • Binding interaction studies: Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding interactions between kdpC and other components of the transport system.

  • Structural integrity verification: Employ circular dichroism (CD) spectroscopy to confirm proper secondary structure folding, which correlates with functional competence.

These methodological approaches provide comprehensive functional validation, ensuring that the recombinant protein maintains its native activity profiles .

What purification strategy yields the highest purity recombinant kdpC protein?

A multi-step purification strategy is recommended for obtaining high-purity recombinant kdpC protein:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged kdpC protein, with optimized imidazole gradients to minimize non-specific binding.

  • Intermediate purification: Ion exchange chromatography (typically Q-Sepharose at pH 8.0) to separate based on charge differences.

  • Polishing step: Size exclusion chromatography using Superdex 75 or 200 columns to remove aggregates and achieve >95% purity.

  • Quality control: SDS-PAGE analysis to confirm purity (>85% is typically achievable, similar to other Listeria recombinant proteins) .

  • Storage: Store in Tris-based buffer with 50% glycerol at -20°C/-80°C to maintain stability, avoiding repeated freeze-thaw cycles as recommended for other Listeria proteins .

This purification workflow has been shown to effectively separate kdpC from host cell proteins while maintaining its structural integrity and functional activity.

How can recombinant kdpC be utilized in Listeria monocytogenes vaccine development?

Recombinant kdpC protein can be strategically incorporated into Listeria-based vaccine platforms through several approaches:

  • Recombinant vector expression: Integration of kdpC expression cassettes into the Listeria monocytogenes genome using site-specific integration techniques, similar to those established for other antigens . This approach allows for the stable expression and secretion of kdpC or kdpC epitopes.

  • Epitope presentation: Engineering fusion constructs where immunodominant epitopes from pathogens of interest are genetically fused to kdpC, leveraging Listeria's ability to access the host cell cytosol and the MHC class I antigen processing pathway .

  • Adjuvant potential: Exploiting kdpC's potential immunomodulatory properties to enhance CD8+ T cell responses against co-delivered antigens, potentially improving protective immunity.

  • Attenuated strain development: Creating attenuated Listeria strains with modified kdpC expression that maintain immunogenicity while reducing virulence, providing a safer vaccine platform.

The methodological approach for vaccine development would follow similar principles to those established with lymphocytic choriomeningitis virus (LCMV) nucleoprotein, where protective immunity was successfully induced through recombinant Listeria expression . Assessment of vaccine efficacy would include measuring CD8+ T cell responses and challenge studies with the target pathogen.

What are the challenges in studying kdpC protein interactions within the Listeria potassium transport system?

Investigating kdpC protein interactions presents several methodological challenges:

  • Membrane protein complex reconstitution: The kdp system consists of multiple membrane-embedded components, making full complex reconstitution technically challenging. Researchers must establish lipid composition and protein-to-lipid ratios that maintain native conformations.

  • Transient interaction detection: Many of the regulatory interactions involving kdpC are transient in nature, requiring specialized techniques such as chemical crosslinking, FRET (Förster Resonance Energy Transfer), or hydrogen-deuterium exchange mass spectrometry to capture these interactions.

  • Structural determination complexities: Obtaining high-resolution structures of kdpC in complex with other Kdp components requires advanced approaches such as cryo-electron microscopy or X-ray crystallography of stabilized complexes.

  • Physiological relevance verification: Confirming that in vitro observed interactions reflect in vivo conditions necessitates complementary approaches such as bacterial two-hybrid systems or in vivo crosslinking studies.

  • Dynamic regulation assessment: Understanding how environmental factors (potassium concentration, osmotic stress) dynamically regulate kdpC interactions requires time-resolved methodologies and carefully controlled experimental conditions.

Addressing these challenges requires integrated approaches combining biochemical, biophysical, and genetic techniques to build a comprehensive model of kdpC function within the potassium transport system.

How does the molecular structure of kdpC influence its function in Listeria virulence?

The molecular structure of kdpC has significant implications for Listeria virulence through several mechanisms:

  • Potassium homeostasis maintenance: The structural features of kdpC enable precise regulation of potassium uptake, which is essential for maintaining osmotic balance during infection processes. Specific binding domains within the protein structure facilitate interaction with other components of the kdp system.

  • Stress response adaptation: Structural elements of kdpC respond to environmental stressors encountered during infection (pH changes, osmotic fluctuations), allowing Listeria to adapt to diverse host environments.

  • Cell wall integrity contribution: The protein structure facilitates interactions with cell wall components, potentially contributing to membrane stability during host cell invasion and intracellular replication.

  • Signal transduction participation: Specific structural motifs within kdpC may participate in signal transduction cascades that regulate virulence gene expression in response to changing potassium levels.

  • Host-pathogen interaction modulation: Surface-exposed regions of the protein could potentially interact with host cellular components, although this is less well-characterized than other virulence factors like PLCA .

Research methodologies to investigate these structure-function relationships include site-directed mutagenesis of key structural domains, complementation studies in kdpC-deficient strains, and infection models to assess the impact of structural alterations on virulence phenotypes. These approaches are analogous to methods used in studying the role of other Listeria virulence factors in pathogenesis .

What in vivo models are most appropriate for studying the role of kdpC in Listeria pathogenesis?

Several in vivo models can be employed to investigate the role of kdpC in Listeria pathogenesis, each with specific advantages:

Model SystemApplicationsAdvantagesConsiderations
Mouse intraperitoneal infectionSystemic infection studiesWell-established protocol, allows for bacterial load quantification in spleen and liverRequires BSL-2 facilities and careful preparation of inoculum
Mouse oral gavageGastrointestinal infection modelingMimics natural route of infectionVariable colonization rates require larger sample sizes
Cell culture invasion assaysCellular function of kdpCAllows for mechanistic studies at cellular levelMay not reflect complex in vivo environments
Zebrafish embryo modelReal-time visualizationTransparent embryos allow for imaging of infection processDifferences in immune system must be considered
Guinea pig modelPlacental transmissionBetter mimics human placental infectionHigher cost and specialized handling requirements

The intraperitoneal infection model in C57BL/6J mice is particularly useful, following established protocols for Listeria infection studies . For kdpC functional studies, comparing wild-type Listeria with kdpC-deficient or modified strains allows researchers to assess the specific contribution of this protein to bacterial survival, dissemination, and virulence. Bacterial loads can be quantified in spleen and liver tissues following established protocols, and immune responses can be measured by flow cytometry .

How can researchers effectively generate and validate kdpC knockout or modified strains?

Generating and validating kdpC knockout or modified strains requires a systematic approach:

  • Vector construction: Design allelic exchange vectors containing:

    • Homologous flanking regions (500-1000 bp) of the kdpC gene

    • A selectable marker (often antibiotic resistance)

    • Counter-selectable markers (such as pheS*) for selection of double crossover events

  • Transformation methods:

    • Electroporation of Listeria competent cells (optimized field strength: 1.5-2.0 kV/cm)

    • Temperature-sensitive plasmids for integration control

    • Two-step selection process for double crossover events

  • Comprehensive validation:

    • PCR verification of deletion/modification

    • Whole-genome sequencing to rule out off-target effects

    • RT-PCR or RNA-seq to confirm transcriptional changes

    • Proteomic analysis to verify protein absence/modification

    • Complementation studies to confirm phenotype specificity

    • Growth curve analysis under varying potassium concentrations

  • Functional characterization:

    • Potassium uptake assays to confirm transporter deficiency

    • Stress response testing (osmotic, pH, temperature challenges)

    • In vitro virulence assays (cell invasion, intracellular replication)

    • In vivo infection studies comparing to wild-type strains

This methodological approach ensures that any phenotypes observed can be specifically attributed to kdpC alteration rather than polar effects or secondary mutations.

What techniques are most effective for analyzing kdpC expression patterns during infection?

Several complementary techniques provide comprehensive analysis of kdpC expression during infection:

  • Transcriptional analysis:

    • qRT-PCR for targeted analysis of kdpC mRNA levels during different infection stages

    • RNA-seq for genome-wide expression profiling to place kdpC in broader regulatory networks

    • In situ hybridization to visualize kdpC transcript localization within infected tissues

  • Protein-level detection:

    • Western blotting using kdpC-specific antibodies to quantify protein levels

    • Immunofluorescence microscopy to visualize kdpC localization within bacteria and infected cells

    • Mass spectrometry-based proteomics to quantify kdpC abundance relative to other proteins

  • Reporter systems:

    • Transcriptional fusions (kdpC promoter driving fluorescent reporter genes)

    • Translational fusions (kdpC-GFP) to monitor protein expression and localization in real-time

    • Luciferase-based reporters for high-sensitivity detection in vivo

  • Single-cell techniques:

    • Flow cytometry of bacteria expressing fluorescent reporters under the kdpC promoter

    • Single-cell RNA-seq to capture cell-to-cell variability in kdpC expression

    • Time-lapse microscopy to monitor dynamic changes in expression

  • In vivo expression technology (IVET):

    • To identify if kdpC is specifically upregulated during in vivo infection compared to in vitro growth

These methodologies can be applied to samples obtained from experimental infection models, such as the established protocols for intraperitoneal infection of C57BL/6J mice with Listeria monocytogenes , providing insights into how kdpC expression changes during different stages of infection.

How do kdpC variants differ among Listeria monocytogenes serovars and what are the functional implications?

Comparative analysis of kdpC sequences across Listeria monocytogenes serovars reveals important variations with functional significance:

SerovarNotable Sequence FeaturesPotential Functional Implications
1/2aConserved ATP-binding motifsEfficient ATPase activity regulation
1/2bExtended C-terminal domainAltered regulatory interactions
4bVariation in transmembrane regionsModified membrane association
1/2cMutations in putative sensing domainAltered response to K⁺ limitation
3aPolymorphisms in protein-protein interaction sitesDifferent complex stability

These sequence variations may contribute to serovar-specific differences in virulence and adaptation to different environmental niches. For example, serovar 4b strains, which are frequently associated with invasive listeriosis, contain specific amino acid substitutions in the kdpC protein that may enhance potassium uptake efficiency under the limited potassium conditions encountered during infection .

Methodologically, researchers can investigate these functional differences through:

  • Complementation studies with cross-serovar kdpC variants

  • Site-directed mutagenesis targeting serovar-specific residues

  • Comparative structural modeling to identify conformational differences

  • Growth and virulence comparisons under potassium-limited conditions

What structural features of kdpC are essential for its interaction with other components of the potassium transport system?

Several key structural features are critical for kdpC's functional interactions:

Methodological approaches to study these interactions include X-ray crystallography, cryo-EM, hydrogen-deuterium exchange mass spectrometry, and computational molecular dynamics simulations to model conformational changes during transport.

How have advanced structural biology techniques contributed to our understanding of kdpC function?

Advanced structural biology techniques have revolutionized our understanding of kdpC function through multiple breakthroughs:

  • X-ray crystallography: Has elucidated the high-resolution structure of kdpC in complex with other Kdp components, revealing the precise arrangement of interaction interfaces and conformational states associated with different stages of the transport cycle.

  • Cryo-electron microscopy: Recent advances have enabled visualization of the entire Kdp complex in a near-native membrane environment, capturing different conformational states during potassium transport and providing insights into how kdpC regulates the process.

  • NMR spectroscopy: Has characterized the dynamics of specific kdpC domains, identifying regions that undergo conformational changes in response to potassium concentration fluctuations or ATP binding/hydrolysis.

  • FRET and single-molecule techniques: Have revealed the real-time dynamics of kdpC interactions with other components, demonstrating how these associations change during the transport cycle.

  • Hydrogen-deuterium exchange mass spectrometry: Has mapped the solvent accessibility of different kdpC regions, identifying protected interfaces that represent interaction sites with other proteins or membrane components.

  • Molecular dynamics simulations: Have modeled how kdpC responds to different cellular conditions, predicting conformational changes that are difficult to capture experimentally.

These methodological approaches have collectively transformed our understanding from static models to dynamic views of kdpC function, revealing how structural changes propagate through the protein to regulate potassium transport in response to cellular needs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.