Recombinant Listeria monocytogenes serovar 1/2a Protease HtpX homolog (htpX)

What is the structural organization of the Listeria monocytogenes htpX gene and its protein product?

The htpX gene (lmo0963) in L. monocytogenes serovar 1/2a encodes a 304 amino acid protein that functions as a protease homolog and belongs to the M48 family of zinc metalloproteinases . Structurally, the HtpX protein contains four hydrophobic regions (H1–H4) that potentially serve as transmembrane segments, though there is controversy regarding whether the two C-terminal regions are embedded in the membrane .

The amino acid sequence is: MLFEQIAANKRKTIFIILGFFIFVLMVGAAIGIIVWNNYLNGLVLAAVIGAFYILIMVMSSSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIVEDPSPNAFATGISPEKGAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIALVAVIAILSDIAMRMIFWGSLTGGRNNRKSDNNNSGGAQAIIYIVALIFVILAPIIATAIQFALSRNREYLADASAVELTRNPDGLIQALQKISGDSKKMEEVSASSESIYFSSPLKSKKNKPGLFDSHPPISSRIERLENM .

For structural characterization, researchers should employ a combination of computational prediction tools (TMHMM, HMMTOP for transmembrane regions), site-directed mutagenesis of conserved domains, and potentially crystallographic or cryo-EM approaches to resolve the three-dimensional structure.

How does HtpX expression differ across Listeria monocytogenes serotypes?

While the htpX gene appears to be conserved across different L. monocytogenes serotypes (including 1/2a, 4a, and 4b), the search results don't indicate significant functional differences between serotypes . PCR-restriction enzyme analysis (PCR-REA) studies have shown that L. monocytogenes serovar 1/2a strains can be divided into two major genomic groups based on restriction patterns , but specific htpX variations between these groups have not been characterized.

For comparative analysis of htpX across serotypes, researchers should:

• Perform sequence alignments of htpX genes from multiple serotypes

• Conduct quantitative RT-PCR to measure expression levels under identical conditions

• Use western blot analysis with serotype-specific antibodies to assess protein expression

What experimental evidence suggests the function of HtpX in L. monocytogenes?

By analogy with E. coli, where HtpX is part of the heat shock regulon expressed from a sigma 32-dependent promoter, L. monocytogenes HtpX likely plays a role in stress response . In E. coli, overexpression of a truncated HtpX form increases degradation of puromycyl peptides, suggesting involvement in protein quality control .

Studies in Streptococcus gordonii (another Gram-positive bacterium) revealed that insertional inactivation of htpX resulted in changes to adhesiveness, cellular morphology, and surface antigen expression in cells grown at elevated temperatures (41°C) . This suggests HtpX may be involved in surface protein expression and stability during thermal stress, a function potentially shared by the L. monocytogenes homolog.

What expression systems are optimal for producing recombinant L. monocytogenes HtpX?

Recombinant L. monocytogenes HtpX can be expressed in multiple systems:

For L. monocytogenes HtpX, E. coli has been successfully used as an expression host . When expressing this membrane protein, consider:

• Using a low-copy vector with an inducible promoter

• Growing cultures at lower temperatures (16-20°C) after induction

• Including membrane-stabilizing additives in the growth medium

• Adding protease inhibitors during purification to prevent degradation

What methodologies can detect HtpX protease activity in vitro?

An effective approach for assessing HtpX activity is an in vivo semiquantitative protease activity assay system similar to that developed for E. coli HtpX . This system employs:

• Construction of a model substrate (designated XMS1 for E. coli)

• Co-expression of the substrate with wild-type or mutant HtpX

• Detection of cleaved fragments (CL-C and CL-N) using appropriate tags and antibodies

• Quantification of proteolytic efficiency by measuring the ratio of cleaved to uncleaved substrate

For adaptation to L. monocytogenes HtpX, researchers should:

• Design L. monocytogenes-specific model substrates based on predicted cleavage sites

• Optimize expression conditions considering L. monocytogenes HtpX's optimal temperature and pH

• Include appropriate controls (protease-dead mutants with mutations in the zinc-binding motif)

• Validate results with mass spectrometry to confirm cleavage sites

How can researchers generate and characterize htpX gene knockouts in L. monocytogenes?

For creating htpX-deficient strains in L. monocytogenes, researchers could employ:

• Allelic exchange mutagenesis using suicide vectors (e.g., pMAD or pKSV7)

• CRISPR-Cas9 gene editing for scarless deletion

• Transposon mutagenesis followed by screening for htpX disruption

Phenotypic characterization should include:

• Growth curves under normal and stress conditions (heat shock, oxidative stress, acidic pH)

• Assessment of cell morphology and ultrastructure by electron microscopy

• Transcriptomic and proteomic profiling to identify compensatory responses

• In vitro and in vivo virulence assays for pathogenesis-related phenotypes

• Competition assays between wild-type and mutant strains

How does HtpX contribute to stress tolerance mechanisms in L. monocytogenes?

While the search results don't directly address HtpX's role in L. monocytogenes stress responses, studies in E. coli have shown that HtpX is part of the heat shock regulon, suggesting importance in thermal stress response . Knowledge from Streptococcus gordonii indicates that htpX disruption affects cellular properties at elevated temperatures .

To investigate HtpX's contribution to stress tolerance in L. monocytogenes, researchers should:

• Perform comparative survival assays of wild-type and htpX mutants under various stresses (heat, cold, acid, osmotic pressure)

• Analyze the htpX promoter region for stress-responsive elements

• Measure htpX transcription under different stress conditions using qRT-PCR

• Identify HtpX-interacting proteins using co-immunoprecipitation or bacterial two-hybrid systems

• Examine 100S ribosome formation under stress, as seen with other stress-responsive factors like HPF

What is the relationship between HtpX and virulence mechanisms in L. monocytogenes?

L. monocytogenes virulence depends on its ability to survive within host cells and overcome various stresses. While HtpX's direct role in virulence hasn't been established in the search results, its function as a protease may contribute to pathogenicity through:

• Maintaining membrane protein quality during infection

• Processing virulence factors required for host cell invasion or intracellular survival

• Degrading misfolded proteins arising from host-induced stresses

To investigate this relationship, researchers should:

• Compare wild-type and htpX mutant strains in cell invasion and intracellular replication assays

• Conduct in vivo infection studies in appropriate animal models

• Examine the expression of known virulence genes (inlA, inlB, hly) in htpX mutants

• Investigate potential HtpX-dependent processing of virulence-associated membrane proteins

What interplay exists between HtpX and other proteases involved in protein quality control?

As a membrane protease potentially involved in quality control, HtpX likely functions within a network of proteases. In E. coli, HtpX appears to have a complementary role to other proteases in degrading misfolded membrane proteins .

To investigate this interplay in L. monocytogenes, researchers should:

• Identify other proteases with similar functions through genomic analysis

• Generate double/multiple knockout strains to assess functional redundancy

• Perform transcriptomic analysis to identify compensatory expression changes

• Use proteomics to identify accumulated substrates in single vs. multiple protease mutants

• Develop in vitro reconstitution assays with purified proteases and model substrates

What buffer systems and storage conditions optimize recombinant HtpX stability?

According to product information, recombinant L. monocytogenes HtpX should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, 50% glycerol is recommended with aliquoting to avoid freeze-thaw cycles .

For optimal stability during experimental manipulations:

• Maintain protein in buffers containing 0.05-0.1% detergent (DDM, LMNG) to stabilize membrane domains

• Include zinc (10-50 μM ZnCl₂) to maintain the metalloprotease active site

• Keep temperature at 4°C during handling

• Add protease inhibitors (excluding metalloprotease inhibitors if activity is being measured)

• Consider including reducing agents (1-5 mM DTT) to prevent oxidation of cysteine residues

How can researchers identify physiological substrates of HtpX in L. monocytogenes?

Identifying native HtpX substrates represents a significant research challenge. Several complementary approaches should be employed:

• Comparative proteomics between wild-type and htpX-deficient strains under stress conditions

• Substrate-trapping approaches using catalytically inactive HtpX mutants

• In vitro digestion assays with purified HtpX and candidate substrates

• SILAC or iTRAQ quantitative proteomics to identify proteins with altered turnover in htpX mutants

• Terminal sequencing of accumulated proteins in htpX mutants to identify potential cleavage sites

What structural features determine HtpX substrate specificity?

Understanding the basis of HtpX substrate recognition requires detailed structural analysis. While the search results don't provide this information specifically for L. monocytogenes HtpX, researchers can pursue this question through:

• Homology modeling based on related proteases with known structures

• Site-directed mutagenesis of conserved residues in potential substrate-binding regions

• Chimeric protein approaches, swapping domains between HtpX homologs with different specificities

• Peptide library screening to identify preferred cleavage motifs

• Hydrogen-deuterium exchange mass spectrometry to map substrate binding regions

How might HtpX function be exploited for antimicrobial development?

As an essential protease in protein quality control, HtpX represents a potential antimicrobial target. Researchers pursuing this direction should:

• Confirm whether htpX is essential for L. monocytogenes survival under infection-relevant conditions

• Identify structural differences between bacterial and host proteases to ensure selectivity

• Develop high-throughput screening assays for HtpX inhibitors using the protease activity assay system

• Test lead compounds for efficacy against L. monocytogenes in vitro and in infection models

• Characterize resistance mechanisms to HtpX inhibitors

What can comparative genomics reveal about HtpX evolution and function across bacterial species?

Evolutionary analysis of HtpX across bacterial species could provide insights into its functional conservation and specialization. Researchers should:

• Compare htpX sequences across diverse bacterial phyla

• Identify conserved domains and lineage-specific adaptations

• Correlate htpX genetic variants with bacterial lifestyle (pathogenic vs. non-pathogenic)

• Perform phylogenetic analysis to understand evolutionary relationships

• Use synteny analysis to examine conservation of genomic context across species