Recombinant Listeria monocytogenes serovar 1/2a Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Listeria monocytogenes Serovar 1/2a

Listeria monocytogenes is a significant foodborne pathogen known for causing listeriosis, a serious infection with potentially fatal outcomes, particularly in immunocompromised individuals and pregnant women. The bacterium has garnered extensive scientific attention due to its ability to invade and replicate within host cells, making it an important model organism for studying host-pathogen interactions . Among the various serovars of L. monocytogenes, serovar 1/2a represents one of the most commonly isolated strains from both clinical and environmental samples.

Serovar 1/2a strains of L. monocytogenes demonstrate considerable genetic and phenotypic diversity, as evidenced by studies employing PCR and restriction enzyme analysis (REA). Research has shown that strains within this serovar can be divided into distinct molecular types, with no apparent correlation between molecular profiles and strain origins (human, animal, food, or environmental) . This genetic diversity likely contributes to the widespread distribution and adaptability of serovar 1/2a strains across various ecological niches.

The virulence of L. monocytogenes serovar 1/2a strains varies considerably, influenced by factors such as surface structure characteristics and hemolysin production. Studies in mouse models have demonstrated that smooth, hemolytic strains exhibit high virulence and can induce long-lasting immunity, while rough, hemolytic strains show intermediate virulence. In contrast, smooth, non-hemolytic strains display minimal virulence and are rapidly eliminated from infected hosts . Understanding these virulence determinants is crucial for developing effective interventions against listeriosis.

Recombinant Production and Characteristics

The recombinant form of the CrcB1 protein has been produced by expressing the full-length sequence (amino acids 1-118) in Escherichia coli expression systems with an N-terminal histidine tag . This approach allows for efficient production and subsequent purification of the protein for research applications. The use of bacterial expression systems for recombinant protein production offers advantages such as high yield, scalability, and cost-effectiveness.

Handling and Reconstitution

Proper handling and reconstitution of the recombinant CrcB1 protein are essential for maintaining its structural integrity and functionality. Before opening, the vial containing the lyophilized protein should be briefly centrifuged to ensure that all content is at the bottom of the container. After reconstitution, the manufacturer advises against repeated freezing and thawing, suggesting that working aliquots should be stored at 4°C for up to one week to minimize protein degradation . This approach helps preserve the native conformation and activity of the protein for experimental applications.

Research Applications and Potential Uses

The recombinant CrcB1 protein from L. monocytogenes serovar 1/2a has several potential research applications, particularly in studies investigating bacterial physiology, pathogenesis, and host-pathogen interactions. As a membrane protein with transport function, it could serve as a model for studying bacterial membrane protein structure and function, as well as mechanisms of ion homeostasis in bacterial cells.

Vaccine Development Potential

L. monocytogenes has been explored as a potential live vaccine vehicle due to its ability to enter the cytosol of host cells, allowing secreted proteins to efficiently access the endogenous antigen-processing pathway . This characteristic enables the presentation of bacterial antigens by MHC class I molecules, stimulating CD8+ T-cell responses. Recombinant L. monocytogenes strains expressing heterologous antigens have demonstrated efficacy in inducing protective immunity in various experimental models .

While the specific potential of CrcB1 as a vaccine component remains unexplored in the available literature, the established framework for using recombinant L. monocytogenes in vaccine development provides a foundation for investigating this possibility. Membrane proteins like CrcB1 could potentially serve as targets for vaccine-induced immunity or as carriers for heterologous antigens in recombinant vaccine constructs.

Studies of Bacterial Virulence and Pathogenicity

Understanding the role of various proteins in L. monocytogenes virulence and pathogenicity is crucial for developing effective intervention strategies against listeriosis. While CrcB1 is not among the well-characterized virulence factors of L. monocytogenes (such as listeriolysin O or ActA protein), investigating its potential contributions to bacterial survival in host environments could reveal previously unknown aspects of Listeria pathogenesis .

The virulence of L. monocytogenes serovar 1/2a strains varies considerably, as demonstrated by studies in mouse models showing different levels of virulence among smooth hemolytic, rough hemolytic, and smooth non-hemolytic strains . Exploring whether membrane transporters like CrcB1 contribute to these differences in virulence could provide valuable insights into the pathogenic mechanisms of this bacterium.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the solution for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB1; lmo2081; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
crcB1
Target Protein Sequence
MLVNFLLVGFGAALGAMLRYGISVLVKSKWKTNFPSATFFINITGSFLLGFLVSSALGPV WQLFLGTGFMGGYTTFSTFKVESMELKWKTNYRVLFSYLGFTYVFGLIAAFLGMMLGV
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: lmo:lmo2081

STRING: 169963.lmo2081

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria monocytogenes serovar 1/2a and how does it relate to other serotypes?

Listeria monocytogenes (Lm) is a Gram-positive, opportunistic foodborne pathogen capable of causing severe infections in humans and animals. Serovar 1/2a belongs to one of the major phylogenetic lineages of L. monocytogenes, distinct from the lineage containing serotypes 4b, 3b, and 1/2b. Molecular typing methods clearly separate serotype 1/2a from other serotypes, demonstrating its distinctive genetic characteristics .

Serotype 1/2a, along with serotypes 4b and 1/2b, is responsible for most human listeriosis cases. While serotype 4b strains are predominantly associated with epidemic outbreaks of listeriosis, serotype 1/2a is more frequently found in food and environmental samples . Recent research indicates that serotype 1/2a tends to be more commonly associated with hypovirulent clones, particularly CC9 and CC121, which show higher prevalence in meat products and food processing environments .

What are the biological characteristics of L. monocytogenes that make it suitable for recombinant protein expression?

L. monocytogenes possesses unique biological properties that make it particularly valuable for recombinant protein studies. As an intracellular pathogen, it can enter host cells, escape from endocytic vesicles, multiply within the cytoplasm, and spread directly from cell to cell without encountering the extracellular environment . This intracellular lifecycle provides several advantages for recombinant protein expression:

  • Proteins secreted by L. monocytogenes can efficiently enter the pathway for major histocompatibility complex (MHC) class I antigen processing and presentation .

  • The bacterium's ability to access the host cell cytosol allows for direct delivery of expressed proteins to cellular compartments.

  • L. monocytogenes can be genetically modified through stable site-specific integration of expression cassettes into its genome .

These characteristics make L. monocytogenes an excellent vehicle for expressing foreign antigens or proteins for immunological studies and vaccine development.

How are recombinant L. monocytogenes strains typically developed and characterized?

Development of recombinant L. monocytogenes strains involves several key methodological steps:

  • Genetic modification: Researchers have established genetic systems for expression and secretion of foreign proteins based on stable site-specific integration of expression cassettes into the L. monocytogenes genome . This approach ensures stable inheritance of the inserted genetic material.

  • Strain verification: After construction, recombinant strains must be verified using molecular techniques such as PCR-based methods. RAPD-PCR with specific primers (particularly D8635 and M13) has been demonstrated as effective for characterizing and differentiating L. monocytogenes strains .

  • Phenotypic characterization: Recombinant strains are typically evaluated for growth characteristics, protein expression levels, and retention of normal bacterial properties. This includes assessment of survival under various environmental conditions, such as cold storage at 4°C, which can be measured through enumeration of bacterial density over time .

  • Functional validation: For vaccine applications, recombinant strains expressing foreign antigens should be tested for their ability to induce protective immunity against target pathogens, often through animal models .

Characterization MethodApplicationAdvantagesReference
RAPD-PCR with primer D8635Strain differentiationDistinguishes strains from different animals, food samples, and production plants
RAPD-PCR with primer M13Strain differentiationEffective with 80% similarity coefficient
SAU-PCRLimited strain differentiationWorks for strains from animals and food processing plants
Growth curves at 4°CPhenotypic characterizationEvaluates cold adaptation of strains

What are the optimal expression systems for producing recombinant CrcB homolog 1 in L. monocytogenes serovar 1/2a?

When designing expression systems for recombinant L. monocytogenes proteins, including CrcB homolog 1, researchers should consider several factors that influence expression efficiency and protein functionality:

  • Promoter selection: The choice of promoter significantly impacts expression levels. For L. monocytogenes, established genetic systems typically utilize the bacterium's native promoters that provide appropriate expression levels. Researchers have successfully used promoters that allow for controlled expression of foreign antigens, facilitating their efficient secretion and presentation to the host immune system .

  • Signal sequence optimization: For proteins intended for secretion, appropriate signal sequences must be incorporated. L. monocytogenes has natural secretion pathways that can be leveraged by including native signal peptides in the expression construct.

  • Integration site selection: The genomic location for integration of expression cassettes affects stability and expression levels. Site-specific integration of expression cassettes into the L. monocytogenes genome has been established as an effective approach for stable expression .

  • Codon optimization: Adapting the target gene's codon usage to match the preferences of L. monocytogenes can enhance expression efficiency. This is particularly important when expressing genes from evolutionarily distant organisms.

  • Expression vector design: For CrcB homolog 1, which is a membrane protein involved in fluoride ion transport, special considerations regarding membrane targeting and protein topology are necessary. Expression systems should preserve the protein's native structure and function.

When expressing membrane proteins like CrcB homolog 1, researchers should monitor potential toxicity effects that may arise from overexpression, as these can affect bacterial growth and viability. Inducible expression systems may be preferable in such cases to control expression levels.

How can we distinguish between virulent and avirulent strains of L. monocytogenes for recombinant protein production?

Distinguishing between virulent and avirulent L. monocytogenes strains is crucial for research and recombinant protein production applications. Several methodological approaches can be employed:

  • Molecular typing methods: PCR-based methods such as RAPD-PCR with specific primers (D8635 and M13) have proven effective for distinguishing between different L. monocytogenes strains . These methods can help identify hypervirulent versus hypovirulent clones.

  • Genetic markers: Research has identified distinct genetic differences between hypervirulent and hypovirulent clones. Hypervirulent clones (particularly CC1) show adaptations to host environments, while hypovirulent clones (CC9 and CC121) exhibit adaptations to food processing environments .

  • Phenotypic assays:

    • Stress resistance: Hypovirulent clones typically show higher prevalence of stress resistance genes and better survival in the presence of antimicrobial compounds like benzalkonium chloride .

    • Biofilm formation: Hypovirulent clones generally demonstrate enhanced biofilm formation capacity, particularly under sub-lethal concentrations of antimicrobial compounds .

    • Host colonization ability: Hypervirulent clones colonize the intestinal lumen more effectively and invade intestinal tissues more efficiently than hypovirulent strains .

  • Genomic analysis: Comparative genomic approaches can identify genetic elements associated with virulence. For example, certain genes or gene fragments have been found to distinguish epidemic-associated strains from non-epidemic strains .

Strain TypeGenetic FeaturesPhenotypic CharacteristicsEcological NicheReference
Hypervirulent clones (e.g., CC1)Adapted to host environmentBetter intestinal colonization and tissue invasionPredominantly found in dairy products
Hypovirulent clones (e.g., CC9, CC121)Higher prevalence of stress resistance genes, benzalkonium chloride tolerance genesHigher survival and biofilm formation in presence of antimicrobialsPredominantly found in meat products and food processing environments

What are the most reliable PCR-based methods for identifying and characterizing L. monocytogenes strains expressing recombinant proteins?

Several PCR-based methods have been evaluated for their reliability in identifying and characterizing L. monocytogenes strains, which is essential when working with recombinant strains expressing proteins like CrcB homolog 1:

  • RAPD-PCR with primer D8635: This method has demonstrated superior differentiation capability, successfully distinguishing L. monocytogenes strains obtained from different animal species, food samples, and even strains from the same production plant isolated at different times . This makes it particularly valuable for epidemiological investigations and tracking recombinant strains.

  • RAPD-PCR with primer M13: This method also provides good differentiation results, though the coefficient of similarity needs to be increased to 80% for optimal results . It complements the D8635 primer method and can be used for verification.

  • SAU-PCR method: This approach involves DNA digestion with Sau3A restriction endonuclease followed by amplification with a primer designed on the restriction site. While this method shows some utility, it provides appreciable results only for certain strains, specifically those isolated from animals and food processing plants .

  • RAPD-PCR with primer P1254: This method has limited differentiation capability compared to other approaches .

For characterizing recombinant L. monocytogenes strains expressing specific proteins, researchers should employ a combination of these PCR-based methods along with specific PCR targeting the inserted gene of interest. This multi-method approach ensures accurate identification and characterization of the recombinant strains.

PCR MethodDifferentiation CapabilityOptimal ApplicationLimitationsReference
RAPD-PCR with primer D8635HighDistinguishing strains from different sources and time periodsRequires stringent PCR conditions
RAPD-PCR with primer M13Good (with 80% similarity coefficient)Complementary verificationRequires adjusted similarity threshold
SAU-PCRLimitedSpecific strains from animals and food processing plantsNot universally applicable
RAPD-PCR with primer P1254LowLimited applicationsLess reliable for strain differentiation

How should experiments be designed to study the function of CrcB homolog 1 in different L. monocytogenes strains?

To effectively study the function of CrcB homolog 1 in different L. monocytogenes strains, researchers should implement a comprehensive experimental design that addresses various aspects of protein function and regulation:

  • Strain selection: Include diverse L. monocytogenes strains representing different serotypes, especially 1/2a, 4b, and 1/2b, which are responsible for most human cases . Consider both hypervirulent (e.g., CC1) and hypovirulent (e.g., CC9, CC121) strains to understand potential functional differences in different genetic backgrounds .

  • Gene expression analysis:

    • Quantify native crcB1 expression levels across strains using RT-qPCR under various environmental conditions.

    • Analyze expression patterns in response to relevant stressors, particularly fluoride exposure.

    • Investigate co-expression patterns with genes involved in related cellular processes.

  • Functional characterization:

    • Generate crcB1 knockout mutants in multiple strain backgrounds using site-specific integration techniques .

    • Create complemented strains by reintroducing the gene to confirm phenotypes.

    • Assess phenotypic changes by evaluating:

      • Fluoride sensitivity

      • Growth under various stress conditions

      • Biofilm formation capacity

      • Survival in food processing environments

      • Virulence in cellular and animal models

  • Protein localization and interaction studies:

    • Create fluorescent protein fusions to visualize CrcB1 localization within bacterial cells.

    • Perform protein-protein interaction studies to identify binding partners.

    • Conduct structural analyses to understand membrane topology and functional domains.

  • Comparative genomics:

    • Analyze crcB1 sequence variations across strains.

    • Correlate sequence polymorphisms with functional differences.

    • Compare with crcB homologs in other bacterial species.

This experimental design provides a comprehensive framework for understanding CrcB homolog 1 function across different L. monocytogenes strains, enabling researchers to correlate genetic variations with functional differences and potential roles in environmental adaptation or virulence.

What are the critical controls required when evaluating the immunogenicity of recombinant L. monocytogenes proteins?

When evaluating the immunogenicity of recombinant L. monocytogenes proteins, including CrcB homolog 1, implementing appropriate controls is essential for generating reliable and interpretable data:

  • Strain controls:

    • Wild-type L. monocytogenes: Essential for comparing immune responses between wild-type and recombinant strains.

    • Empty vector control: L. monocytogenes containing the expression vector without the target gene insert.

    • Irrelevant protein control: L. monocytogenes expressing an unrelated protein using the same expression system.

  • Immunological controls:

    • CD8+ T cell depletion: As demonstrated in vaccine studies, in vivo depletion of CD8+ T cells can determine whether protective immunity is mediated by this cell population .

    • CD4+ T cell depletion: To assess the contribution of helper T cells to the immune response.

    • Antibody neutralization: To evaluate the role of specific cytokines or immune mediators.

  • Challenge controls:

    • Naive animal control: Unimmunized animals to establish baseline susceptibility to challenge.

    • Positive control immunization: Animals immunized with a known protective antigen or vaccine.

    • Dose titration: Multiple challenge doses to determine the degree of protection.

  • Analytical controls:

    • Isotype controls: For flow cytometry and antibody-based assays.

    • Technical replicates: To assess assay variability.

    • Biological replicates: To account for individual variation in immune responses.

  • Expression verification controls:

    • Protein expression quantification: Western blot or ELISA to confirm and quantify target protein expression.

    • Localization confirmation: To verify proper secretion or surface display of the recombinant protein.

The importance of these controls is highlighted by research demonstrating that protective immunity induced by recombinant L. monocytogenes vaccine strains can be abrogated by CD8+ T cell depletion, confirming that protection is mediated by this specific cell population . This type of control allows researchers to definitively establish the immunological mechanisms responsible for observed protective effects.

How can researchers address data inconsistencies when studying strain-specific differences in protein expression?

Researchers frequently encounter data inconsistencies when studying strain-specific differences in protein expression, particularly with membrane proteins like CrcB homolog 1. Addressing these inconsistencies requires systematic analytical approaches:

  • Methodological standardization:

    • Implement consistent protocols for bacterial growth, protein extraction, and analysis across all strains.

    • Standardize culture conditions (temperature, media composition, growth phase) to minimize variation.

    • Process all samples simultaneously when possible to reduce batch effects.

  • Statistical approaches:

    • Perform sufficient biological replicates (minimum n=3, preferably n≥5) to account for natural biological variation.

    • Apply appropriate statistical tests that consider data distribution characteristics.

    • Use mixed-effects models to account for batch variation and repeated measures.

    • Consider Bayesian approaches for integrating prior knowledge with new experimental data.

  • Technical validation:

    • Verify findings using orthogonal methods (e.g., if using RT-qPCR for expression analysis, confirm with protein quantification).

    • For recombinant protein expression, confirm using multiple detection methods (western blot, activity assays, mass spectrometry).

    • Validate antibody specificity when using immunological detection methods.

  • Genetic verification:

    • Sequence the target gene locus in all strains to identify potential polymorphisms affecting expression or detection.

    • Verify the integrity of expression systems using PCR-based methods established for L. monocytogenes characterization .

    • Consider whole genome sequencing to identify distant genetic elements that might influence expression.

  • Environmental control:

    • Systematically test various environmental conditions that might affect protein expression.

    • Include controls for stress responses that might be differentially activated in various strains.

    • Monitor growth curves and cell viability to ensure comparable physiological states.

How can recombinant L. monocytogenes expressing CrcB homolog 1 be utilized in vaccine development?

Recombinant L. monocytogenes strains expressing proteins of interest have demonstrated significant potential as vaccine vectors. For CrcB homolog 1 or other L. monocytogenes proteins, several approaches can be implemented in vaccine development:

  • Antigen delivery platform: L. monocytogenes possesses unique biological properties that make it an excellent vehicle for delivering antigens to the immune system. The bacterium's ability to enter host cells and access the cytosol allows proteins secreted by L. monocytogenes to efficiently enter the pathway for MHC class I antigen processing and presentation, effectively stimulating CD8+ T cell responses .

  • Expression system design: For effective vaccine development, researchers should establish a genetic system for stable expression and secretion of the target antigen. This can be achieved through site-specific integration of expression cassettes into the L. monocytogenes genome, as demonstrated in previous studies .

  • Immunogenicity evaluation: When developing recombinant L. monocytogenes vaccines, immunogenicity must be systematically assessed:

    • Animal immunization studies should evaluate both humoral and cellular immune responses.

    • Protection against challenge with relevant pathogens should be demonstrated.

    • The role of specific immune components (e.g., CD8+ T cells) can be determined through depletion studies, as shown in research where CD8+ T cell depletion abrogated protective immunity conferred by L. monocytogenes vaccine strains .

  • Adjuvant potential: Recent research has identified molecular mechanisms underlying vaccine efficacy. For example, the transcription factor CREB1 and its target genes have been associated with improved immunogenicity and reduced pathogen acquisition in vaccine trials . Understanding these mechanisms could inform the development of more effective L. monocytogenes-based vaccines.

  • Safety considerations: When developing vaccine candidates, researchers must address safety concerns:

    • Use of attenuated L. monocytogenes strains to minimize pathogenic potential.

    • Genetic stability assessment to ensure consistent antigen expression.

    • Evaluation of potential reversion to virulence or unintended effects.

The potential of L. monocytogenes as a vaccine platform is demonstrated by successful protection against heterologous pathogens in animal models . This approach could be adapted for various antigens, including those targeting bacterial, viral, or parasitic infections.

What role does protein expression heterogeneity play in the virulence and adaptation of different L. monocytogenes strains?

Protein expression heterogeneity significantly influences the virulence and adaptive capabilities of different L. monocytogenes strains. Understanding these differences is crucial for characterizing strain-specific behaviors and developing targeted interventions:

  • Virulence heterogeneity: Research has demonstrated that L. monocytogenes strains exhibit varying levels of virulence, which can be classified into hypervirulent and hypovirulent clones . These differences in virulence correlate with distinct protein expression patterns:

    • Hypervirulent clones (particularly CC1) show adaptations to host environments, with enhanced ability to colonize the intestinal lumen and invade intestinal tissues .

    • Hypovirulent clones (CC9 and CC121) exhibit adaptations to food processing environments, with higher expression of stress resistance genes and better survival in the presence of antimicrobial compounds .

  • Environmental adaptation: Protein expression heterogeneity reflects adaptation to distinct ecological niches:

    • Hypervirulent clones are predominantly associated with dairy products, suggesting adaptation to this specific food matrix .

    • Hypovirulent clones show stronger association with meat products and food processing environments .

    • These associations likely result from different contamination routes and selective pressures in these environments.

  • Stress response variation: Different L. monocytogenes strains exhibit varying levels of stress response proteins, affecting their survival under adverse conditions:

    • Hypovirulent clones show higher prevalence of stress resistance genes and benzalkonium chloride tolerance genes .

    • This translates to higher survival rates and enhanced biofilm formation capacity in the presence of sub-lethal concentrations of antimicrobial compounds .

  • Public health implications: Understanding protein expression heterogeneity across L. monocytogenes strains has important public health implications:

    • It can help improve food safety measures by targeting strain-specific vulnerabilities.

    • It allows for more accurate risk assessment based on strain characteristics.

    • It can inform food consumption recommendations for at-risk populations based on strain prevalence in different food types .

The heterogeneity in protein expression among L. monocytogenes strains demonstrates the bacterium's remarkable adaptability to diverse environments. This plasticity allows different strains to occupy specific ecological niches and exhibit distinct patterns of virulence and environmental persistence.

How can computational approaches enhance our understanding of CrcB homolog 1 function in L. monocytogenes?

Computational approaches offer powerful tools for investigating protein function, particularly for membrane proteins like CrcB homolog 1 where experimental characterization can be challenging. Several computational strategies can enhance our understanding of this protein:

  • Sequence-based analyses:

    • Homology identification: Comparing CrcB homolog 1 sequences across bacterial species to identify conserved domains and functional motifs.

    • Evolutionary analysis: Constructing phylogenetic trees to understand the evolutionary relationships between CrcB homologs in different bacterial species and strains.

    • Variation analysis: Analyzing sequence polymorphisms across L. monocytogenes strains to identify potential functional variations.

  • Structural bioinformatics:

    • Protein structure prediction: Using algorithms like AlphaFold2 to predict the three-dimensional structure of CrcB homolog 1.

    • Molecular dynamics simulations: Simulating protein behavior in membrane environments to understand conformational changes and ion transport mechanisms.

    • Structure-function relationship analysis: Mapping conserved residues onto predicted structures to identify functionally important regions.

  • Systems biology approaches:

    • Gene co-expression network analysis: Identifying genes with expression patterns similar to crcB1 to infer functional relationships.

    • Protein-protein interaction prediction: Computational prediction of proteins that might interact with CrcB homolog 1.

    • Pathway analysis: Integrating expression data with known biological pathways to understand the role of CrcB homolog 1 in cellular processes.

  • Comparative genomics:

    • Genomic context analysis: Examining the genomic neighborhood of crcB1 across different strains to identify potential operons or functionally related genes.

    • Pan-genome analysis: Determining the distribution and conservation of crcB1 across the L. monocytogenes pan-genome.

    • Horizontal gene transfer assessment: Investigating potential acquisition of crcB variants through horizontal gene transfer.

  • Machine learning applications:

    • Function prediction: Using trained models to predict protein function based on sequence features.

    • Expression pattern prediction: Developing models to predict expression under various environmental conditions.

    • Virulence association: Identifying correlations between CrcB variants and virulence phenotypes.

By integrating these computational approaches with experimental data, researchers can develop comprehensive models of CrcB homolog 1 function and its role in L. monocytogenes biology, potentially revealing new targets for intervention strategies against this pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.