Recombinant Listeria monocytogenes serovar 1/2a Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; lmo2082; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
crcB2
Target Protein Sequence
MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMRFLAEKSRVSLV LLNGIGTGFIGAFTTFSAFSVDTIQLVQSGAWLFAVSYVLASFIGGLIMVKFGRMLSNKL LNRGEHRVG
Uniprot No.

Target Background

Function
Plays a critical role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: lmo:lmo2082

STRING: 169963.lmo2082

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key genetic features of Listeria monocytogenes serovar 1/2a strains that express crcB2?

Listeria monocytogenes serovar 1/2a strains can be divided into two distinct genetic profiles based on PCR-Restriction Enzyme Analysis (PCR-REA). Studies examining 100 strains of L. monocytogenes serovar 1/2a from diverse sources (human, animal, food, and environmental samples) identified two major profiles: profile 1/2a:I (70% of strains) and profile 1/2a:II (30% of strains) . The distribution of these profiles showed no clear correlation with strain origin. When studying crcB2 expression patterns, it's essential to first characterize your strain's genetic profile to understand potential variations in gene regulation and expression.

For genetic characterization, researchers should use PCR amplification of the 2,916 bp region containing the downstream end of inlA (955 bp), the space between inlA and inlB (85 bp), and 1,876 bp of inlB, followed by AluI restriction enzyme digestion . This method provides reliable differentiation between the two major genetic profiles of serovar 1/2a strains.

How do genomic islands influence the expression and function of membrane proteins like crcB2 in different L. monocytogenes strains?

Genomic islands significantly impact the expression and function of membrane proteins in L. monocytogenes. The stress survival islet 1 (SSI-1) is present in 33.3% of L. monocytogenes isolates globally, while SSI-2 appears in 11.8%, and SSI-F2365 in 54.8% of isolates . These genomic islands contribute to stress resistance, which may indirectly affect membrane protein function including crcB2.

For studying the relationship between genomic islands and crcB2 expression, researchers should:

  • Confirm the presence/absence of SSI-1, SSI-2, and SSI-F2365 in their strains

  • Compare crcB2 expression levels between strains with different genomic island profiles

  • Perform stress response experiments (pH, oxidative stress) to evaluate correlations between stress resistance and crcB2 function

A methodical approach would include RT-qPCR analysis of crcB2 expression under various stress conditions, comparing strains with different genomic island compositions.

What is the optimal experimental design for studying crcB2 expression across different environmental conditions?

The Randomized Complete Block Design (RCBD) is highly recommended for studying crcB2 expression across different environmental conditions. This design controls for experimental variation by grouping similar experimental units into blocks or replicates, ensuring that observed differences between treatments are primarily due to true treatment effects rather than experimental noise .

For crcB2 expression studies, implement RCBD as follows:

  • Define your treatments (e.g., different pH levels, temperatures, or media compositions)

  • Organize experimental units (bacterial cultures) into uniform blocks

  • Randomize treatment assignment within each block

  • Include sufficient replication (minimum three replicates recommended)

Treatment FactorRep 1Rep 2Rep 3Rep 4
pH 5.0T1T3T4T2
pH 6.0T3T1T2T4
pH 7.0T4T2T1T3
pH 8.0T2T4T3T1

T1-T4 represent different strains or experimental conditions being tested

The RCBD approach offers several advantages for crcB2 research:

  • Greater precision than completely randomized designs

  • Flexibility in the number of treatments or replicates

  • Ability to handle missing data

  • Valid comparisons even with heterogeneous experimental error

What purification strategies yield the highest activity for recombinant crcB2 protein?

For optimal purification of active recombinant crcB2 protein, a systematic approach addressing membrane protein challenges is essential:

  • Expression system selection: E. coli BL21(DE3) with a pET vector system containing a 6×His tag for purification is recommended for initial attempts. For challenging expression, consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Induction conditions: Optimize by testing multiple conditions:

    • Temperature: 16°C, 25°C, and 37°C

    • IPTG concentration: 0.1 mM, 0.5 mM, and 1.0 mM

    • Induction time: 4h, 8h, and overnight

  • Extraction and solubilization:

    • Extract membrane fraction using ultracentrifugation (100,000×g for 1h)

    • Screen detergents systematically:

DetergentConcentrationSolubilization EfficiencyProtein Activity
DDM1%+++++
LMNG0.1%+++++
Triton X-1001%++++
SDS0.5%+++-
  • Purification protocol:

    • IMAC purification using Ni-NTA resin

    • Size exclusion chromatography for final polishing

    • Maintain detergent above CMC throughout purification

For functional assays, reconstitute purified crcB2 into liposomes composed of E. coli polar lipids and test for fluoride transport activity using fluoride-sensitive electrodes or fluorescent probes.

How does crcB2 contribute to L. monocytogenes virulence and intracellular survival?

The relationship between crcB2 and L. monocytogenes virulence must be examined in the context of established virulence factors. L. monocytogenes pathogenicity relies on several key genetic elements:

To study crcB2's contribution to virulence:

  • Create crcB2 knockout mutants using homologous recombination or CRISPR-Cas9

  • Compare wild-type and mutant strains in:

    • Fluoride resistance assays

    • Growth under various pH conditions

    • Intracellular survival in macrophage and epithelial cell models

    • Mouse infection models

Analyze how crcB2 expression correlates with expression of known virulence factors using RNA-seq and qRT-PCR under various environmental conditions to establish potential regulatory connections.

What bioinformatic approaches are most effective for predicting crcB2 structure-function relationships?

For comprehensive crcB2 structure-function prediction, employ a multi-layered bioinformatic approach:

  • Sequence analysis and homology detection:

    • Perform PSI-BLAST against SwissProt and PDB databases

    • Use HHpred for sensitive homology detection

    • Identify conserved motifs using MEME and FIMO

  • Structural prediction:

    • Use AlphaFold2 or RoseTTAFold for accurate tertiary structure prediction

    • Validate predictions with multiple tools (I-TASSER, SWISS-MODEL)

    • Perform molecular dynamics simulations to assess stability

  • Functional annotation:

    • Identify functionally important residues through conservation analysis

    • Use ConSurf to map conservation onto structural models

    • Perform virtual mutagenesis to predict critical residues

  • Integration with experimental data:

    • Map known mutations affecting function to the structural model

    • Use structure-guided approaches to design targeted mutations for experimental validation

Create a comprehensive visualization mapping sequence conservation, predicted functional domains, and membrane topology to guide experimental designs focusing on key regions.

How can recombinant L. monocytogenes strains with modified crcB2 be used as vaccine vectors?

L. monocytogenes has unique capabilities as a vaccine vector due to its ability to live in the cytoplasm of host cells, effectively targeting protein antigens to the cellular arm of the immune response . For developing crcB2-modified strains as vaccine vectors:

  • Vector construction strategy:

    • Create attenuated L. monocytogenes strains through crcB2 modification

    • Design expression constructs where crcB2 fusion proteins present antigenic epitopes

    • Utilize secretion signals to ensure antigen delivery to the cytosol

  • Safety considerations:

    • Confirm attenuated virulence through in vitro and in vivo models

    • Evaluate genetic stability through multiple passages

    • Assess potential for environmental spread

  • Efficacy testing:

    • Measure antigen-specific T-cell responses using ELISpot and flow cytometry

    • Perform challenge studies in appropriate disease models

    • Compare with conventional vaccination approaches

Research has demonstrated that recombinant L. monocytogenes can not only protect against lethal challenges but can also cause regression of established macroscopic tumors in an antigen-specific, T-cell-dependent manner . This suggests that crcB2-modified strains might serve as effective immunotherapeutic agents when properly engineered.

What are the latest methodologies for studying protein-protein interactions involving crcB2?

To comprehensively map the interactome of crcB2, employ a multi-method approach:

  • In vivo cross-linking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSS or formaldehyde

    • Perform immunoprecipitation of tagged crcB2

    • Analyze crosslinked peptides using high-resolution MS/MS

    • Use specialized software (pLink, xQuest) to identify interaction partners

  • Proximity-based labeling:

    • Generate crcB2 fusions with BioID or APEX2

    • Identify proximal proteins through biotinylation and streptavidin pulldown

    • Compare interactomes under different conditions (pH, fluoride exposure)

  • Fluorescence-based interaction assays:

    • Implement split-GFP complementation to visualize interactions in living cells

    • Use FRET or BRET to measure direct interactions in real-time

    • Apply fluorescence recovery after photobleaching (FRAP) to assess dynamics

  • Computational prediction validation:

    • Use protein docking software to predict interactions

    • Validate predictions through targeted mutagenesis of interface residues

    • Perform molecular dynamics simulations of predicted complexes

MethodAdvantagesLimitationsBest Applications
XL-MSCaptures direct interactions, works with endogenous levelsComplex data analysis, limited coverageIdentifying direct binding partners
BioIDMaps proximal proteins, works in native conditionsSlow labeling kinetics, backgroundMapping membrane protein neighborhoods
Split-GFPVisual confirmation in living cellsPotential interference with functionConfirming predicted interactions
FRET/BRETReal-time interaction dynamicsRequires protein taggingStudying interaction kinetics

How should researchers address discrepancies in crcB2 expression data between different experimental approaches?

When facing discrepancies in crcB2 expression data, implement a systematic troubleshooting approach:

  • Methodological validation:

    • Verify primer specificity through sequencing and BLAST analysis

    • Perform standard curve analysis for all qPCR assays (R² > 0.98)

    • Validate antibody specificity using knockout controls

    • Include appropriate housekeeping genes validated for stability across conditions

  • Statistical reconciliation:

    • Apply transformation methods appropriate to your data distribution

    • Use mixed-effects models to account for batch effects

    • Implement Bayesian approaches to integrate discrepant datasets

    • Calculate effect sizes rather than relying solely on p-values

  • Biological context integration:

    • Consider strain-specific genetic variation (profile 1/2a:I vs. 1/2a:II)

    • Evaluate the presence/absence of stress survival islets (SSI-1, SSI-2, SSI-F2365)

    • Assess growth phase effects through time-course experiments

    • Examine regulators that might influence crcB2 expression

  • Confirmation experiments:

    • Design orthogonal validation experiments using different methodologies

    • Include tissue/condition-specific positive controls

    • Perform spike-in experiments to evaluate technical variables

Remember that L. monocytogenes strains show significant genetic diversity, with two major profiles identified within serovar 1/2a . This genetic heterogeneity may explain expression differences between strains from different sources.

What statistical approaches are most appropriate for analyzing crcB2 functional assay data?

For robust statistical analysis of crcB2 functional data:

  • Experimental design considerations:

    • Implement Randomized Complete Block Design (RCBD) to control for experimental variation

    • Ensure adequate replication (minimum n=4 recommended)

    • Include appropriate positive and negative controls

  • Preliminary data assessment:

    • Test for normality using Shapiro-Wilk test

    • Evaluate homogeneity of variance with Levene's test

    • Identify and handle outliers using robust statistical methods

  • Analysis methods by experiment type:

Experiment TypeRecommended AnalysisAlternative ApproachesRequired Sample Size
Single factor comparisonOne-way ANOVA with Tukey post-hocKruskal-Wallis (non-parametric)n ≥ 4 per group
Multi-factor experimentsTwo-way ANOVA with interaction termsLinear mixed modelsn ≥ 3 per condition
Time-course studiesRepeated measures ANOVAGrowth curve analysisn ≥ 3 per timepoint
Dose-responseFour-parameter logistic regressionEC50 comparisonn ≥ 5 concentrations
  • Advanced statistical considerations:

    • Use linear mixed models to account for random effects

    • Apply ANCOVA when covariates influence outcomes

    • Implement bootstrap methods for robust confidence intervals

    • Consider Bayesian approaches for complex experimental designs

When analyzing RCBD experiments, calculate the correction factor (CF) as (Y..)²/(r*t) where Y.. is the grand total, r is the number of replicates, and t is the number of treatments . This approach maximizes the precision of your analysis while accounting for experimental variability.

What are common challenges in recombinant crcB2 expression and how can they be addressed?

Membrane proteins like crcB2 present specific expression challenges that require systematic troubleshooting:

  • Low expression levels:

    • Test codon-optimized sequences for L. monocytogenes genes

    • Evaluate multiple promoter strengths (T7, tac, ara)

    • Screen various E. coli strains (BL21, C41/C43, Rosetta)

    • Use fusion partners (MBP, SUMO) to enhance solubility

  • Protein aggregation:

    • Decrease expression temperature (16-20°C)

    • Reduce inducer concentration

    • Add chemical chaperones (glycerol 5-10%, arginine 50-100 mM)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Extraction difficulties:

    • Systematic detergent screening (start with mild detergents)

    • Test different extraction buffers (pH 6.0-8.0)

    • Optimize lipid:detergent:protein ratios

    • Use native nanodiscs for membrane extraction

  • Functional validation:

    • Design complementation assays in fluoride-sensitive strains

    • Develop fluoride-specific transport assays

    • Implement label-free methods to assess binding

For each challenge, implement a matrix-based optimization approach, systematically varying multiple parameters simultaneously to identify optimal conditions efficiently.

How can researchers overcome PCR-REA challenges when characterizing L. monocytogenes serovar 1/2a strains?

When facing challenges with PCR-Restriction Enzyme Analysis of L. monocytogenes serovar 1/2a strains:

  • PCR optimization strategies:

    • Implement touchdown PCR for improved specificity

    • Use high-fidelity polymerases for long amplicons (>2 kb)

    • Add PCR enhancers (DMSO 5%, betaine 1M) for GC-rich regions

    • Test gradient PCR to optimize annealing temperatures

  • DNA extraction considerations:

    • Compare multiple extraction protocols (commercial kits vs. phenol-chloroform)

    • Include additional purification steps for high-quality DNA

    • Quantify and standardize DNA input for consistent results

    • Evaluate DNA integrity through gel electrophoresis

  • Restriction digest troubleshooting:

    • Extend digestion time for complete restriction (overnight at optimal temperature)

    • Use high-quality restriction enzymes with star activity protection

    • Include control DNA with known digestion patterns

    • Optimize enzyme:DNA ratio for complete digestion

  • Alternative approaches when PCR-REA fails:

    • Implement nested PCR approaches for difficult templates

    • Develop strain-specific multiplex PCR assays

    • Consider whole-genome sequencing for comprehensive characterization

    • Use LAMP assays for rapid strain identification

Remember that two distinct profiles (1/2a:I and 1/2a:II) have been identified among L. monocytogenes serovar 1/2a strains , and accurate classification is essential for interpreting crcB2 expression and functional data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.