Recombinant Listeria monocytogenes serovar 1/2a UPF0154 protein lmo1306 (lmo1306)

What is Listeria monocytogenes and why is it significant in vaccine research?

Listeria monocytogenes (LM) is a Gram-positive bacterium with unique cellular properties that make it valuable for vaccine development. It can enter host cells, escape from endocytic vesicles, multiply within the cytoplasm, and spread directly from cell to cell without encountering the extracellular environment . The most significant characteristic for immunological research is LM's ability to access the host cell cytosol, allowing proteins secreted by the bacterium to efficiently enter the pathway for major histocompatibility complex (MHC) class I antigen processing and presentation . This property enables LM to stimulate strong CD8+ T-cell responses, making it an excellent candidate for recombinant vaccine development against various pathogens and tumors .

What is the UPF0154 protein lmo1306 and what are its structural characteristics?

The lmo1306 protein is a member of the UPF0154 protein family found in Listeria monocytogenes serovar 1/2a. The full-length protein consists of 79 amino acids with the sequence: MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK . The protein contains hydrophobic regions that suggest membrane association, which is consistent with its potential role in Listeria's cellular functions . When produced recombinantly, it is typically expressed with an N-terminal His-tag to facilitate purification and downstream applications .

How does recombinant Listeria monocytogenes induce immune responses?

Recombinant Listeria monocytogenes induces immune responses through several mechanisms:

• Direct access to MHC class I pathway: When LM enters the host cell cytosol, proteins secreted by the bacterium are processed and presented by MHC class I molecules, leading to CD8+ T cell activation .

• Inflammatory cell death mechanisms: LM induces immunogenic cell death pathways such as pyroptosis and necroptosis in immune cells, which favorably regulate immunological responses .

• Long-term memory induction: Vaccination with recombinant LM strains expressing heterologous antigens can induce long-term immunological memory and CD8+ T-cell-mediated protective immunity .

In experimental models, CD8+ T cell-dependent protective immunity has been demonstrated by in vivo depletion studies, where removal of CD8+ T cells from vaccinated mice abrogated their ability to clear viral infections, confirming the mechanism of protection .

What expression systems are optimal for producing recombinant lmo1306 protein?

The optimal expression system for recombinant lmo1306 protein is E. coli, specifically strains designed for high-level protein expression such as BL21 DE3 or Rosetta™ 2 DE3 . The protein is typically expressed with an N-terminal His-tag to facilitate purification . Based on the available research:

• Expression vector selection: The pRSETa expression vector system has been successfully used, allowing site-specific integration of expression cassettes .

• Culture conditions: Optimal expression is achieved in liquid LB medium with induction using 0.5 mM IPTG at 30°C rather than 37°C to reduce inclusion body formation .

• Antibiotic selection: When using appropriate E. coli strains, cultures should be maintained with ampicillin (50 μg/ml) and, if using Rosetta strains, chloramphenicol (34 μg/ml) .

What purification protocols yield the highest purity of recombinant lmo1306?

Based on established methodologies for similar recombinant proteins from Listeria, the following purification protocol can yield high-purity lmo1306 protein (>90% purity):

• Cell lysis: Resuspend induced cell pellets in denaturing lysis buffer (100 mM sodium phosphate, 10 mM Tris, 8 M Urea, 20 mM imidazole, pH 8.0) followed by ultrasonication in 5 pulses of 30 seconds with one-minute intervals at 4°C .

• Affinity chromatography: Purify the His-tagged protein using nickel affinity chromatography under denaturing conditions with appropriate washing and elution buffers containing increasing concentrations of imidazole .

• Refolding (if necessary): If the protein is obtained under denaturing conditions, controlled dialysis against buffers with decreasing concentrations of denaturants can facilitate proper folding .

• Quality control: Verify purity using SDS-PAGE, with expected purity greater than 90% as determined by densitometry analysis .

What are the optimal storage conditions for maintaining recombinant lmo1306 stability?

To maintain the stability and activity of recombinant lmo1306 protein, the following storage conditions are recommended:

• Short-term storage: For working aliquots, store at 4°C for up to one week .

• Long-term storage: Store the protein at -20°C/-80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles .

• Storage formulation: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 . For extended storage stability, add glycerol (final concentration 50%) .

• Reconstitution protocol: If stored as a lyophilized powder, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol for long-term storage .

Repeated freezing and thawing significantly reduces protein stability and should be avoided .

How can recombinant Listeria monocytogenes be utilized as a vaccine vector?

Recombinant Listeria monocytogenes can be engineered as a vaccine vector through the following methodological approach:

• Genetic engineering: Establish a site-specific integration of expression cassettes into the LM genome to allow stable expression and secretion of heterologous antigens .

• Antigen selection: Choose antigenic determinants from the target pathogen or tumor that are likely to elicit protective T-cell responses. Both full-length proteins and specific epitopes have proven effective .

• Vaccination protocol: Administer the recombinant LM strain to induce CD8+ T-cell-mediated immunity against the target antigen. Experimental models typically use intravenous or oral routes of administration .

• Challenge model: Evaluate protective efficacy by challenging immunized subjects with the target pathogen or tumor. In LCMV models, protection against virulent strains that otherwise establish chronic infections has been demonstrated .

This approach has been successfully demonstrated with lymphocytic choriomeningitis virus (LCMV) nucleoprotein and in cottontail rabbit papillomavirus models for anti-tumor immunity .

What functional analysis methodologies are appropriate for characterizing lmo1306 protein?

Several methodological approaches can be employed for the functional characterization of lmo1306:

How can researchers optimize gene design for heterologous expression of lmo1306?

Optimizing gene design for heterologous expression of lmo1306 involves several considerations:

• Codon optimization: Design and optimize synthetic genes for expression in the target host (e.g., E. coli) using algorithms that consider codon frequency in the host organism .

• mRNA structural considerations: Analyze and modify the gene sequence to optimize mRNA secondary structure, GC content, and avoid restrictive motifs that might impair translation .

• Epitope prediction: For immunological applications, perform prediction of linear B cell epitopes using tools like BCPred1.2 to ensure antigenic regions are preserved .

• Fusion strategies: Consider designing expression constructs with appropriate fusion partners or tags that enhance folding, solubility, or purification without compromising functional domains .

• Regulatory elements: Incorporate appropriate promoters, ribosome binding sites, and termination sequences optimized for the expression system .

Software tools like LETO 1.0 have been successfully used to optimize genes for heterologous expression, considering factors such as reading phase, codon frequency, mRNA secondary structure, and GC content .

What mechanisms explain the CD8+ T cell activation by Listeria-delivered antigens, and how might this apply to lmo1306?

The CD8+ T cell activation by Listeria-delivered antigens involves several sophisticated mechanisms:

• Cytosolic access and MHC class I presentation: LM escapes from phagosomes into the cytosol, allowing bacterial proteins to be processed by the proteasome and presented on MHC class I molecules to CD8+ T cells . If lmo1306 were used as a carrier for heterologous epitopes, this pathway would facilitate their presentation.

• Listeriolysin O (LLO) activity: The pore-forming toxin LLO is crucial for vacuolar escape and can also activate mitogen-activated protein (MAP) kinase pathways in host cells . This creates an inflammatory environment conducive to T cell activation.

• Inflammatory cell death: LM induces pyroptosis and necroptosis through molecules such as caspase-1/11, GSDMD, RIPK3, and MLKL, which favorably control immune responses . Research suggests that host response to Listeria-based vectors and subsequent CD8+ T cell induction may be compromised in the absence of these regulatory molecules .

• Persistent infection in vacuoles: LLO also plays a role in the formation of spacious Listeria-containing phagosomes (SLAPs), promoting bacterial replication in vacuoles and leading to persistent infection . This prolonged antigen presentation may enhance memory T cell development.

Understanding these mechanisms could inform strategies to engineer lmo1306 as an antigen carrier or adjuvant in vaccination approaches.

How do protein contaminants in recombinant preparations affect experimental outcomes, and what purification strategies minimize these effects?

Protein contaminants in recombinant preparations can significantly impact experimental outcomes through several mechanisms:

• Interference with functional assays: Contaminants may possess enzymatic activities that confound functional assays, leading to false positive or negative results .

• Immunological interference: In vaccine studies, contaminants may stimulate unintended immune responses or contain immunosuppressive factors .

• Toxicity effects: Industrial solvents and heavy metals that may contaminate protein preparations can exert cellular toxicity, affecting viability assays and experimental interpretation .

Based on published findings regarding protein supplement analysis, common contaminants include:

To minimize contaminant effects, researchers should:

• Implement multi-step purification strategies combining affinity chromatography with ion exchange or size exclusion chromatography .

• Use high-sensitivity analytical techniques like gas chromatography coupled to mass spectrometry to detect and quantify trace contaminants .

• Include appropriate controls with analytical grade references and calibration standards .

• Document purification protocols thoroughly, including internal standards, calibration checks, and validation protocols per industry standards .

What are the experimental design considerations for studying the unfolded protein response in relation to recombinant protein expression?

The unfolded protein response (UPR) can significantly impact recombinant protein expression systems and should be considered in experimental design:

• Time-course analysis: Include multiple time points when monitoring UPR induction, as evidenced by studies showing that the ratio of spliced versus unspliced XBP1 mRNA oscillates over treatment courses, reflecting the dynamic nature of the UPR .

• Multi-parameter monitoring: Simultaneously assess transcriptome changes (by high-throughput sequencing), proteome alterations (by shotgun and targeted proteomics), and translation status (by ribosome profiling) to comprehensively understand UPR effects .

• UPR markers selection: Include established UPR markers such as:

  • XBP1 mRNA splicing (detectable by RT-PCR)

  • PERK phosphorylation (detectable by Western blot mobility shift)

  • EIF2S1 phosphorylation at Ser51 (detectable by phospho-specific antibodies)

• Metabolic considerations: Account for UPR-dependent metabolic reprogramming that may divert metabolites from glycolysis to mitochondrial one-carbon metabolism, potentially affecting experimental outcomes and protein yields .

• Stress induction controls: Include positive controls for UPR induction and carefully titrate expression conditions to minimize unintended stress responses that may confound results .

How should researchers interpret functional analysis data for novel proteins like lmo1306?

Interpreting functional analysis data for novel proteins like lmo1306 requires a systematic approach:

• Convergent validity assessment: Compare results from multiple analytical methods, as different interpretation methods may yield varying outcomes. Research has shown poor agreement between interpretation methods for experimental functional analyses .

• Reliability evaluation: Consider the test-retest reliability of functional analyses over different time periods. Studies indicate that experimental functional analyses may have poor test-retest reliability, necessitating replicate experiments at varying intervals (e.g., 2 weeks, 1 month, and 3 months) .

• Sequence-function relationship: Analyze the amino acid sequence (e.g., MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK for lmo1306) for structural motifs that might suggest function, such as transmembrane domains, signal sequences, or binding sites .

• Comparative genomics: Place findings in the context of related proteins from other bacterial species, especially those with known functions, to generate hypotheses about lmo1306 function .

• Integrative analysis: Combine data from multiple sources, including expression patterns, protein interactions, and phenotypic effects of gene deletion/modification to build a comprehensive functional profile .

What statistical approaches are most appropriate for analyzing protective immunity induced by recombinant Listeria vaccines?

When analyzing protective immunity induced by recombinant Listeria vaccines, researchers should employ appropriate statistical approaches:

• Survival analysis: For challenge studies with lethal pathogens or aggressive tumors, Kaplan-Meier survival curves with log-rank tests should be used to compare vaccinated and control groups .

• T-cell response quantification: For analysis of antigen-specific T-cell responses:

  • Use paired t-tests or Wilcoxon signed-rank tests for comparing pre- and post-vaccination responses within subjects

  • Apply ANOVA or Kruskal-Wallis tests with appropriate post-hoc comparisons for multiple group studies

  • Include power calculations based on expected effect sizes from preliminary data

• Pathogen burden assessment: When quantifying pathogen loads post-challenge:

  • Transform data (often log transformation) to achieve normal distribution

  • Apply mixed-effects models to account for repeated measures

  • Use non-parametric alternatives when data violate parametric assumptions

• Correlative analyses: To identify immune correlates of protection:

  • Employ multivariate regression models

  • Consider machine learning approaches for complex datasets

  • Validate findings with independent datasets when possible

• Depletion studies: For mechanistic studies involving in vivo depletion of specific cell types (e.g., CD8+ T cells), include appropriate isotype controls and quantification of depletion efficiency, with statistical comparisons between depleted and non-depleted groups .

How can researchers address data contradictions in functional analyses of recombinant proteins?

Addressing data contradictions in functional analyses of recombinant proteins requires a systematic troubleshooting approach:

• Methodological reconciliation: Different analytical methods may yield contradictory results. Researchers should:

  • Compare experimental conditions across studies

  • Evaluate reagent sources and quality

  • Consider differences in detection sensitivity

• Protein form considerations: Contradictions may arise from differences in protein forms (full-length vs. truncated, tagged vs. untagged). For example, fragments of lmo1306 might exhibit different activities than the full-length protein :

  • Compare amino acid sequences used across studies

  • Assess the impact of tags on protein function

  • Consider post-translational modifications

• Meta-analytical approach: When contradictions persist, systematically review:

  • Sample sizes and statistical power

  • Effect sizes and confidence intervals

  • Publication bias potential

• Experimental resolution strategies:

  • Design decisive experiments specifically targeting contradictions

  • Include positive and negative controls

  • Use multiple orthogonal methods to address the same question

  • Consider blind experimental design and independent replication

• Reporting transparency: When publishing results that contradict previous findings, researchers should:

  • Explicitly acknowledge contradictions

  • Propose biological or methodological explanations

  • Present all relevant data, including negative results

By applying these approaches, researchers can resolve contradictions and advance understanding of protein function more effectively.