Recombinant Listeria monocytogenes serovar 1/2a UPF0266 membrane protein lmo0779 (lmo0779)

Shipped with Ice Packs
In Stock

Description

Functional Roles in L. monocytogenes Pathogenesis

Lmo0779 contributes to bacterial virulence and stress resistance under specific regulatory conditions:

Oxidative Stress Resistance

  • In prfA* hypervirulent mutants, Lmo0779 enhances resistance to hydrogen peroxide (H₂O₂) .

  • Transposon inactivation of lmo0779 reduces bacterial survival in oxidative environments by 40–60%, specifically in prfA* strains .

  • Structural predictions suggest its C-terminal domain may coordinate metal ions to mitigate reactive oxygen species (ROS) .

Organ-Specific Virulence

  • Murine infection models show that lmo0779 disruption in prfA* strains reduces liver colonization by ~2 logs, but spleen colonization remains unaffected .

  • No significant role is observed in wild-type L. monocytogenes, indicating context-dependent functionality tied to PrfA activation .

  • Pathogenicity Studies: Used to dissect PrfA-regulated virulence mechanisms and organ-specific tropism .

  • Oxidative Stress Assays: Functional studies leverage its ROS resistance phenotype in prfA* mutants .

  • Diagnostic Development: Available as an ELISA antigen (50 µg aliquots) for antibody validation .

Limitations and Future Directions

  • Structural Uncertainty: The exact metal-binding mechanism of the C-terminal domain remains unvalidated .

  • Host-Specific Effects: Recombinant expression in E. coli may alter post-translational modifications absent in native Listeria .

  • Therapeutic Potential: Unexplored as a drug target due to its niche role in prfA* contexts .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lmo0779; UPF0266 membrane protein lmo0779
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
lmo0779
Target Protein Sequence
MVWDATNIFLFAANILTVLYILYNDAVIPLWKGKTVLSVKLRSRGRWDGYIFVGIIVLLF VSNTFFREGPFSTSVLLGIMGVLFIYICFFRSSKAVFKESGLFYALLFFPYAKIERMNLS EDGVLVIETNRQRLMLFARSEKDLEKMLAVFTTYS
Uniprot No.

Target Background

Database Links

KEGG: lmo:lmo0779

STRING: 169963.lmo0779

Protein Families
UPF0266 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria monocytogenes serovar 1/2a and why is it significant for research?

Listeria monocytogenes is a Gram-positive bacterium with considerable research importance due to its unique intracellular lifecycle. Serovar 1/2a specifically has gained increased attention as strains belonging to serogroup 1/2 have become increasingly prevalent in human listeriosis cases, making them particularly relevant for clinical and food safety research . L. monocytogenes has the remarkable ability to enter host cells, escape from endocytic vesicles, multiply within the cytoplasm, and spread directly between cells without encountering the extracellular environment . This intracellular capability allows proteins secreted by the bacterium to efficiently enter the major histocompatibility complex class I antigen processing pathway, making it valuable for immunological research and vaccine development .

What is the UPF0266 membrane protein lmo0779 and what are its known functions?

The UPF0266 membrane protein lmo0779 is a protein encoded in the L. monocytogenes genome. The "UPF" designation (Uncharacterized Protein Family) indicates that while this protein has been identified, its precise biological function remains incompletely characterized. As a membrane protein, lmo0779 is integrated into cellular membranes, suggesting potential roles in cellular processes such as transport, signaling, or membrane integrity maintenance. Research into lmo0779 continues to elucidate its specific functions within L. monocytogenes biology, particularly in relation to pathogenicity and survival mechanisms.

How can researchers differentiate between strains of L. monocytogenes serovar 1/2a?

Researchers can effectively differentiate between L. monocytogenes serovar 1/2a strains using PCR combined with restriction enzyme analysis (PCR-REA). In a comprehensive study of 100 strains, researchers amplified a 2,916 bp segment containing the downstream end of the gene inlA (955 bp), the space between inlA and inlB (85 bp), and a portion (1,876 bp) of the gene inlB . Following amplification, the segment was cleaved with the restriction enzyme AluI, and the resulting fragments were separated using gel electrophoresis . This methodology revealed two distinct restriction profiles among serovar 1/2a strains, with 70% of strains sharing one profile and the remaining 30% sharing a second profile . This typing approach provides a valuable tool for differentiating strains in epidemiological investigations and outbreak tracking.

What are the recommended protocols for PCR-REA analysis of lmo0779 and related genes in L. monocytogenes serovar 1/2a?

For successful PCR-REA analysis of lmo0779 and related genes in L. monocytogenes serovar 1/2a, researchers should implement the following methodological approach:

PCR Amplification Protocol:

  • Design primers targeting the inlA-inlB region that includes lmo0779 (if relevant to this region)

  • Prepare PCR reaction mixtures with high-fidelity DNA polymerase to ensure accurate amplification of the target segment

  • Implement thermal cycling conditions optimized for L. monocytogenes genomic DNA, typically including initial denaturation at 95°C, followed by 30-35 cycles of denaturation, annealing (temperature dependent on primer design), and extension

  • Verify successful amplification via gel electrophoresis

Restriction Enzyme Analysis:

  • Digest the purified PCR products with AluI restriction enzyme (or alternative restriction enzymes as appropriate for the target sequence)

  • Incubate digestion reactions at the optimal temperature (typically 37°C for AluI) for 1-3 hours

  • Separate restriction fragments using agarose gel electrophoresis (2-3% agarose depending on expected fragment sizes)

  • Document and analyze restriction patterns using gel imaging systems

When analyzing results, researchers should compare restriction profiles with established patterns for serovar 1/2a strains to identify genetic variants and potential relationships between clinical, food, animal, and environmental isolates . This approach allows for detailed molecular epidemiological investigations of L. monocytogenes strains.

How can researchers optimize purification of recombinant lmo0779 to maintain structural integrity and functionality?

Optimizing purification of recombinant lmo0779 while maintaining its structural and functional integrity requires a carefully designed strategy that considers the membrane protein's hydrophobic nature. The following methodological approach is recommended:

Expression System Selection:

  • For structural studies: Insect cell or mammalian expression systems provide necessary post-translational modifications

  • For high-yield applications: E. coli or yeast expression with optimized codons and appropriate fusion tags

Solubilization Protocol:

  • Extract membrane fractions using differential centrifugation

  • Screen multiple detergents (DDM, LMNG, SDS) at varying concentrations to identify optimal solubilization conditions

  • Include appropriate protease inhibitors throughout to prevent degradation

Purification Strategy:

  • Implement affinity chromatography using His-tag or other fusion tags

  • Follow with size exclusion chromatography to separate aggregates

  • Consider ion exchange chromatography as a polishing step

  • Maintain detergent concentrations above critical micelle concentration throughout purification

Quality Assessment:

  • Verify purity using SDS-PAGE and Western blotting

  • Assess structural integrity through circular dichroism or thermal shift assays

  • Confirm functionality through appropriate activity assays specific to predicted function

By carefully optimizing each step in this process, researchers can obtain purified recombinant lmo0779 suitable for downstream structural and functional characterization studies.

What strategies are most effective for evaluating the role of lmo0779 in L. monocytogenes pathogenicity?

Evaluating the role of lmo0779 in L. monocytogenes pathogenicity requires a multi-faceted approach combining genetic manipulation, cellular models, and in vivo systems. The most effective research strategy includes:

Genetic Manipulation Approaches:

  • Generate precise gene deletions (Δlmo0779) using homologous recombination or CRISPR-Cas systems

  • Create complemented mutants to verify phenotypes

  • Develop point mutations in functional domains to identify critical residues

  • Consider conditional expression systems for essential genes

In Vitro Cellular Assays:

  • Assess bacterial invasion efficiency in epithelial cell lines

  • Quantify intracellular growth curves in macrophages and other relevant cell types

  • Evaluate cytopathic effects and cell-to-cell spread capabilities

  • Analyze cytokine responses in infected immune cells

In Vivo Infection Models:

  • Determine bacterial burden in mouse infection models

  • Assess virulence attenuation through survival studies

  • Evaluate tissue tropism and dissemination patterns

  • Analyze immune responses to wild-type versus mutant strains

Comparative Analysis:

  • Compare phenotypes with related membrane proteins

  • Assess impacts across multiple L. monocytogenes strains and serovars

  • Evaluate effects under various environmental conditions mimicking host environments

This comprehensive approach allows researchers to thoroughly characterize the contribution of lmo0779 to L. monocytogenes pathogenicity across multiple experimental systems.

How should researchers design experiments to investigate potential interactions between lmo0779 and host cell proteins?

When investigating interactions between lmo0779 and host cell proteins, researchers should implement a systematic experimental design that progresses from initial screening to detailed characterization:

Initial Interaction Screening:

  • Yeast two-hybrid screening with lmo0779 as bait against human cDNA libraries

  • Pull-down assays using purified His-tagged lmo0779 and host cell lysates

  • Proximity labeling approaches (BioID or APEX) in infected cells

  • Co-immunoprecipitation of tagged lmo0779 from infected cells

Confirmation of Direct Interactions:

  • Surface plasmon resonance to determine binding kinetics

  • Microscale thermophoresis for quantitative interaction analysis

  • ELISA-based binding assays with recombinant proteins

  • Fluorescence resonance energy transfer (FRET) in cellular contexts

Functional Characterization:

  • Domain mapping to identify interaction interfaces

  • Mutagenesis of key residues to disrupt interactions

  • Competitive inhibition assays to validate specificity

  • Structural studies of protein complexes (X-ray crystallography or cryo-EM)

Cellular Context Validation:

  • Co-localization studies using fluorescence microscopy

  • Time-course analysis of interactions during infection

  • Impact of interaction disruption on bacterial virulence

  • Host cell response changes when interactions are prevented

This structured approach ensures rigorous characterization of potential interactions between lmo0779 and host cell proteins, providing insights into the molecular mechanisms of L. monocytogenes pathogenesis.

How can researchers interpret contradictory data when studying lmo0779 function across different L. monocytogenes strains?

When encountering contradictory data regarding lmo0779 function across different L. monocytogenes strains, researchers should employ a systematic analytical framework:

Data Validation Steps:

  • Verify strain identities through molecular typing (PCR-REA or whole genome sequencing)

  • Confirm experimental conditions are truly comparable across studies

  • Re-examine methodological differences that could impact outcomes

  • Validate reagents and ensure absence of contamination

Analytical Approaches for Resolving Contradictions:

  • Perform comprehensive sequence analysis of lmo0779 across strains to identify potentially significant variations

  • Examine strain-specific genetic backgrounds that might influence phenotypic outcomes

  • Consider epigenetic differences or regulatory variations between strains

  • Evaluate experimental variables including growth conditions, physiological state of bacteria, and host cell factors

Addressing strain diversity:
In a study of L. monocytogenes serovar 1/2a, researchers found two distinct genetic profiles using PCR-REA analysis, demonstrating significant genetic diversity even within the same serovar . This diversity could explain functional differences observed when studying lmo0779 across multiple strains. Researchers should classify strains according to established genetic profiles (e.g., 1/2a:I or 1/2a:II) when interpreting functional data to account for this underlying genetic variation .

By systematically analyzing contradictory results through this framework, researchers can develop more nuanced models of lmo0779 function that account for strain-specific variations and contextual factors.

What statistical approaches are most appropriate for analyzing lmo0779 expression data in different experimental conditions?

When analyzing lmo0779 expression data across experimental conditions, researchers should select statistical approaches based on experimental design, data distribution, and research questions:

Preprocessing Steps:

  • Evaluate data quality through normalization against housekeeping genes

  • Assess data distribution and determine if parametric assumptions are met

  • Identify and handle outliers and missing data points using established frameworks

  • Transform data if necessary to meet statistical test assumptions

Statistical Analysis Selection:

  • For comparing two conditions: t-test (parametric) or Mann-Whitney U test (non-parametric)

  • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni, etc.)

  • For time-course experiments: repeated measures ANOVA or mixed-effects models

  • For complex designs: consider multivariate approaches (MANOVA, PCA, or clustering)

Advanced Analytical Approaches:

  • For correlating expression with phenotypic outcomes: regression analysis or correlation testing

  • For identifying co-expressed genes: network analysis or clustering algorithms

  • For comparing across studies: meta-analysis approaches with appropriate effect size calculations

  • For environmental variable impacts: consider factorial designs with interaction terms

Handling Missing Data:
When dealing with incomplete expression datasets, researchers should follow established frameworks for addressing missing data in observational studies . This includes developing an analysis plan specifying how missing data will be addressed, examining data patterns, and transparently reporting results alongside missing data descriptions .

How can researchers leverage L. monocytogenes serovar 1/2a as a recombinant vaccine vector?

L. monocytogenes offers unique advantages as a recombinant vaccine vector due to its ability to access the host cell cytosol, allowing secreted proteins to efficiently enter the major histocompatibility complex class I antigen processing pathway . Researchers can leverage this property through the following methodological approach:

Vector Development:

  • Establish genetic systems for stable site-specific integration of expression cassettes into the L. monocytogenes genome

  • Design expression systems that ensure efficient secretion of target antigens

  • Consider attenuated strains to maintain safety while preserving immunogenicity

  • Incorporate appropriate selection markers for stable maintenance

Antigen Selection and Expression:

  • Design constructs expressing complete target proteins or defined epitopes

  • Test various promoters and signal sequences to optimize antigen expression

  • Validate antigen production and secretion in vitro before in vivo studies

  • Consider fusion proteins to enhance immunogenicity

Immunological Evaluation:

  • Assess protective efficacy against heterologous pathogens in appropriate animal models

  • Perform CD8+ T cell depletion studies to confirm the mechanism of protection

  • Evaluate memory responses through delayed challenge experiments

  • Compare responses to conventional vaccine approaches

Clinical Translation Considerations:

  • Establish rigorous attenuation to ensure safety in human applications

  • Develop production processes maintaining genetic stability

  • Consider route of administration to optimize protective immune responses

  • Design monitoring protocols for adverse events

This approach has been successfully demonstrated with L. monocytogenes strains expressing lymphocytic choriomeningitis virus (LCMV) nucleoprotein, which conferred protection against virulent LCMV challenge . CD8+ T cell depletion studies confirmed that protection was mediated by CD8+ T cell responses , highlighting the value of this platform for inducing cell-mediated immunity.

What role might membrane proteins like lmo0779 play in developing attenuated Listeria vaccine strains?

Membrane proteins like lmo0779 may serve crucial roles in developing attenuated L. monocytogenes vaccine strains through multiple mechanisms:

Attenuation Strategies Targeting Membrane Proteins:

  • Deletion or mutation of membrane proteins involved in cellular invasion

  • Modification of proteins required for phagosomal escape

  • Alteration of membrane proteins essential for intracellular replication

  • Targeting proteins involved in cell-to-cell spread

Potential Advantages of lmo0779 Modification:

  • If involved in pathogenesis, its modification could reduce virulence while maintaining immunogenicity

  • As a membrane protein, it may affect bacterial surface interactions with host cells

  • Modifications might alter intracellular behavior without compromising antigen delivery

  • Its conservation across strains may provide broad-spectrum attenuation

Experimental Approach to Evaluate lmo0779 for Attenuation:

  • Generate precise deletions or functional mutations in lmo0779

  • Assess impact on bacterial growth in vitro and in vivo

  • Evaluate effects on critical virulence properties (invasion, intracellular growth, cell-to-cell spread)

  • Determine immunogenicity and protective efficacy of mutant strains

Considerations for Vaccine Development:

  • Ensure genetic stability of attenuations during manufacturing

  • Verify attenuated phenotype across diverse genetic backgrounds

  • Balance attenuation with maintenance of immunostimulatory properties

  • Consider combination with other attenuating mutations for enhanced safety

By strategically modifying membrane proteins like lmo0779, researchers may develop attenuated L. monocytogenes strains that maintain the advantageous immunological properties while eliminating pathogenic potential, creating safer vaccine vectors.

What emerging technologies will advance our understanding of proteins like lmo0779?

Several cutting-edge technologies are poised to revolutionize our understanding of bacterial membrane proteins like lmo0779:

Structural Biology Advancements:

  • Cryo-electron microscopy for high-resolution membrane protein structures without crystallization

  • Integrative structural biology combining multiple techniques (NMR, X-ray, molecular dynamics)

  • Serial femtosecond crystallography at X-ray free-electron lasers for dynamic structural studies

  • AlphaFold and other AI-driven structural prediction tools for initial structural insights

Functional Genomics Approaches:

  • CRISPR interference (CRISPRi) for precise transcriptional regulation without genomic modification

  • Tn-Seq and TraDIS for high-throughput functional screening under infection-relevant conditions

  • RNA-Seq and Ribo-Seq for transcriptional and translational profiling during infection

  • Spatial transcriptomics to map bacterial gene expression within infected tissues

Advanced Imaging Techniques:

  • Super-resolution microscopy for visualizing membrane protein organization

  • Live-cell imaging with genetically encoded biosensors to track protein dynamics

  • Correlative light and electron microscopy for contextual protein localization

  • Expansion microscopy to physically enlarge bacterial cells for enhanced visualization

Systems Biology Integration:

  • Multi-omics approaches integrating proteomics, transcriptomics, and metabolomics

  • Network analysis to place lmo0779 in broader functional contexts

  • Machine learning algorithms to identify patterns in large-scale datasets

  • Computational modeling of membrane protein dynamics in bacterial membranes

These emerging technologies will provide unprecedented insights into the structure, function, and biological significance of membrane proteins like lmo0779, potentially revealing new targets for therapeutic intervention and vaccine development.

How might comparative genomics across Listeria strains inform future research on lmo0779?

Comparative genomics approaches across diverse Listeria strains can provide valuable insights into lmo0779 function and evolution:

Evolutionary Analysis Approaches:

  • Phylogenetic analysis of lmo0779 across Listeria species and strains

  • Identification of selection pressures through dN/dS ratio analysis

  • Assessment of recombination events affecting the lmo0779 locus

  • Comparison of genomic context and operon structure across strains

Functional Inference Strategies:

  • Correlation of sequence variations with phenotypic differences

  • Identification of conserved domains suggesting critical functions

  • Analysis of strain-specific variations in virulence-associated strains

  • Comparison with homologous proteins in related bacterial species

Strain Diversity Considerations:
PCR-REA analysis has demonstrated that L. monocytogenes serovar 1/2a strains can be divided into two distinct groups (profiles 1/2a:I and 1/2a:II) . This genetic diversity within the serovar suggests that comparative genomic approaches may reveal significant variations in membrane proteins like lmo0779 that could influence bacterial phenotypes. Researchers should ensure representation of both profiles in comparative studies.

Data Integration Framework:

  • Combine whole genome sequencing data with phenotypic characterization

  • Correlate lmo0779 variations with ecological niches and host adaptation

  • Integrate transcriptomic data to identify strain-specific expression patterns

  • Link genomic features to proteomics profiles across diverse conditions

By implementing these comparative genomics approaches, researchers can develop testable hypotheses about lmo0779 function, identify critical structural elements, and potentially discover strain-specific adaptations that influence pathogenicity and host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.