Recombinant Listeria monocytogenes serovar 1/2a UPF0344 protein lmo2265 (lmo2265)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
lmo2265; UPF0344 protein lmo2265
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
lmo2265
Target Protein Sequence
MWGYIHLISWVAIVVLTITALLIYSKSTKSFTMLQMINRVFYILVILSGIMMVKYSIEQS WILAIFKILMGIIVIGVVEMLLSYRKQQKPTGMFLMIFVIVVVITISLGFYLSGGYPLFN
Uniprot No.

Target Background

Database Links

KEGG: lmo:lmo2265

STRING: 169963.lmo2265

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria monocytogenes serovar 1/2a and its significance in research?

Listeria monocytogenes serovar 1/2a is one of the major serotypes of this Gram-positive foodborne pathogen. It is frequently isolated from humans, animals, food, and environmental sources. This serotype has become increasingly prevalent in human listeriosis cases, making it a significant focus of research. Studies have shown that L. monocytogenes serogroup 1/2 strains have increased in prevalence in human cases, while they are also frequently isolated during routine food examinations . The 1/2a serotype belongs to lineage II of L. monocytogenes, with other serotypes being categorized into four distinct phylogenetic lineages (I, II, III, and IV). This categorization is important for understanding the evolutionary relationships and pathogenic potential of different strains .

What are UPF0344 family proteins in L. monocytogenes?

UPF0344 family proteins belong to the "Uncharacterized Protein Family" classification, indicating that their precise biological functions remain incompletely understood. In L. monocytogenes, these proteins are conserved across various strains but show variation when compared to other Listeria species. Similar to other UPF proteins identified in L. monocytogenes serotype 4b (such as LMOf2365_2298), the UPF0344 protein lmo2265 in serovar 1/2a likely contains regions that are conserved within L. monocytogenes but variable in other Listeria species . This characteristic makes these proteins potentially valuable as species-specific biomarkers for detection and strain differentiation purposes.

How are recombinant L. monocytogenes proteins typically expressed and purified?

Recombinant L. monocytogenes proteins, including those from the UPF0344 family, are typically expressed in E. coli expression systems using vectors that incorporate affinity tags (commonly His-tags) to facilitate purification. For example, the recombinant UPF0344 protein LMOf2365_2298 from L. monocytogenes serotype 4b was expressed in E. coli with an N-terminal His tag for efficient purification . The general workflow involves:

  • Cloning the target gene into an appropriate expression vector

  • Transformation into a compatible E. coli strain

  • Induction of protein expression (often using IPTG for lac promoter-based systems)

  • Cell lysis and extraction

  • Affinity chromatography purification using the incorporated tag

  • Verification of purity via SDS-PAGE and Western blotting

This approach allows for the production of sufficient quantities of purified protein for downstream applications such as antibody generation, structural studies, and functional characterization.

How can recombinant lmo2265 be used for developing detection methods for L. monocytogenes?

Recombinant lmo2265, as a potentially specific surface protein of L. monocytogenes serovar 1/2a, can be utilized to develop highly specific detection methods through the following approaches:

  • Antibody development: Purified recombinant lmo2265 can be used to generate both polyclonal antibodies (PAbs) and monoclonal antibodies (MAbs) with high specificity. Research has shown that antibodies raised against L. monocytogenes surface proteins can effectively bind to bacterial cells, as demonstrated by immunofluorescence microscopy techniques . For example, in a study with another surface protein (LMOf2365_0148), antibodies generated against the recombinant protein showed strong reaction signals when binding to the cell surface .

  • Immunoassay development: These antibodies can then be incorporated into various immunoassay formats:

    • ELISA-based detection systems

    • Immunomagnetic separation methods

    • Lateral flow immunoassays

    • Immunofluorescence-based detection

  • Cross-reactivity assessment: Comprehensive testing against multiple L. monocytogenes lineages and other Listeria species is essential to confirm specificity. A similar approach with LMOf2365_0148 revealed that certain monoclonal antibodies (such as M3686) exhibited reactivity to bacterial isolates from all three lineages of L. monocytogenes under standard enrichment conditions .

What molecular typing methods can differentiate strains expressing variant forms of lmo2265?

Several molecular typing approaches can be employed to differentiate L. monocytogenes strains based on variations in lmo2265 or other marker genes:

PCR-REA (PCR-Restriction Enzyme Analysis):
This method has successfully differentiated L. monocytogenes serovar 1/2a strains into distinct groups. In a study examining 100 strains of L. monocytogenes serovar 1/2a, PCR-REA targeting the internalin genes (inlA and inlB) divided the strains into two distinct profiles (1/2a:I and 1/2a:II) . A similar approach could be applied to lmo2265:

  • PCR amplification of the lmo2265 gene region

  • Digestion with appropriate restriction enzymes (such as AluI)

  • Gel electrophoresis separation of the resulting fragments

  • Analysis of restriction patterns to identify strain variations

Implementation data: When applied to serovar 1/2a strains, PCR-REA successfully categorized 70 strains into profile 1/2a:I and 30 strains into profile 1/2a:II, demonstrating the method's discriminatory power .

Restriction ProfileNumber of StrainsHuman IsolatesAnimal IsolatesFood IsolatesEnvironmental Isolates
1/2a:I702620186
1/2a:II30101334

What is known about the structure-function relationship of UPF0344 proteins in pathogenic bacteria?

While specific structural information for lmo2265 is limited, insights can be drawn from related UPF0344 proteins. These proteins typically contain:

  • Conserved domains: Often containing motifs with potential roles in protein-protein interactions or enzymatic functions

  • Secondary structure elements: Characterized by specific patterns of α-helices and β-sheets that contribute to protein folding and stability

  • Surface-exposed regions: Potentially involved in interactions with host molecules or environmental factors

For comprehensive structural characterization, researchers should consider:

  • X-ray crystallography or NMR spectroscopy for high-resolution structural determination

  • Computational modeling approaches using homology modeling based on related proteins with known structures

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

  • Limited proteolysis coupled with mass spectrometry to identify domain boundaries and flexible regions

Understanding these structural features can provide insights into potential functions and interaction partners of lmo2265 in the context of L. monocytogenes pathogenesis.

How should researchers design experiments to investigate lmo2265 function in L. monocytogenes pathogenesis?

To investigate the potential role of lmo2265 in L. monocytogenes pathogenesis, researchers should consider a multifaceted experimental approach:

Gene knockout/complementation studies:

  • Generate a clean deletion of lmo2265 using allelic exchange techniques

  • Create a complemented strain by reintroducing the gene on a plasmid or at a neutral chromosomal locus

  • Compare the wild-type, knockout, and complemented strains in various assays to determine the protein's function

Cell infection models:
L. monocytogenes has the ability to enter host cells through interactions between its surface proteins and host receptors. For example, internalin (InlA) mediates entry into epithelial cells by interacting with E-cadherin, while InlB facilitates entry into hepatocytes . To study potential roles of lmo2265 in these processes:

  • Assess bacterial invasion efficiency in relevant cell lines (epithelial cells, macrophages, hepatocytes)

  • Quantify intracellular replication rates through time-course experiments

  • Evaluate cell-to-cell spread capabilities using plaque assays

  • Examine colocalization with host cellular compartments through immunofluorescence microscopy

Animal infection models:
When advancing to in vivo studies, researchers should be aware of species-specific interactions. For instance, the interaction between InlA and E-cadherin is species-specific and does not naturally occur in wild-type mice . Options include:

  • Using transgenic or humanized mouse models if lmo2265 interacts with species-specific host factors

  • Employing guinea pig models, which are naturally susceptible to L. monocytogenes

  • Evaluating bacterial burden in relevant organs (liver, spleen, brain) at various time points post-infection

  • Assessing pathological changes and host immune responses

What controls and validation methods are essential when studying recombinant lmo2265 interactions?

When investigating recombinant lmo2265 interactions with potential binding partners or host components, rigorous controls and validation methods are crucial:

Protein quality controls:

  • Assess protein folding through circular dichroism and thermal shift assays

  • Verify size and purity by SDS-PAGE and size exclusion chromatography

  • Confirm identity by mass spectrometry and western blotting

  • Test for endotoxin contamination, especially for immunological studies

Interaction validation methods:

MethodApplicationControl Recommendations
Surface Plasmon Resonance (SPR)Quantitative binding kineticsUse irrelevant protein of similar size; include blank surface control
Pull-down assaysIdentifying binding partnersInclude GST/His-tag only controls; perform competitive inhibition
Co-immunoprecipitationConfirming interactions in cell lysatesUse isotype control antibodies; perform in knockout cell lines
Microscale ThermophoresisMeasuring interactions in solutionInclude labeled protein alone control; perform with competitor
ELISA-based binding assaysHigh-throughput screeningInclude blocking peptides; use titration curves

Functional validation:

  • Demonstrate that purified lmo2265 retains its native properties when added exogenously

  • Show that antibodies against lmo2265 block its function in relevant assays

  • Confirm that genetic complementation restores phenotypes observed in knockout strains

How can multi-omics approaches be applied to understand the role of lmo2265 in L. monocytogenes biology?

Multi-omics approaches integrate multiple molecular analyses to provide comprehensive insights into protein function within the broader biological context. For studying lmo2265, researchers can implement:

Transcriptomics:

  • RNA-seq analysis to compare wild-type and lmo2265 knockout strains under various conditions

  • Identification of genes with altered expression patterns that may be part of the same biological pathway

  • Temporal analysis of gene expression changes during infection or stress conditions

Proteomics:

  • Shotgun proteomics to identify changes in the global protein landscape

  • Targeted proteomics for precise quantification of specific proteins of interest

  • Analysis of protein-protein interaction networks through approaches like BioID or proximity labeling

Integration of datasets:
A comprehensive multi-omics approach can reveal the broader biological context of lmo2265 function. For example, in a study investigating the unfolded protein response in a human astrocytoma cell line, researchers integrated transcriptome data (from high-throughput sequencing), proteome data (from shotgun and targeted proteomics), and translation status information (from ribosome profiling) to identify 267 induced genes . A similar approach could be applied to understand how lmo2265 functions within the bacterial cell's regulatory networks.

What are the most effective approaches for studying potential post-translational modifications of lmo2265?

To comprehensively characterize post-translational modifications (PTMs) of lmo2265, researchers should employ a combination of techniques:

Mass spectrometry-based approaches:

  • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS analysis to identify modified peptides

  • Top-down proteomics: Analysis of intact proteins to preserve modification patterns

  • Targeted MS approaches: Multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) for quantitative analysis of specific modifications

Modification-specific enrichment strategies:

  • Phosphorylation: Immobilized metal affinity chromatography (IMAC) or titanium dioxide (TiO₂) enrichment

  • Glycosylation: Lectin affinity chromatography or hydrazide chemistry

  • Ubiquitination: Ubiquitin remnant antibody enrichment

Validation methods:

  • Site-directed mutagenesis of modified residues to assess functional impact

  • Modification-specific antibodies for western blotting or immunoprecipitation

  • In vitro enzymatic assays to confirm modification by specific enzymes

Understanding the PTM landscape of lmo2265 can provide critical insights into its regulation, localization, and function within L. monocytogenes.

How can recombinant lmo2265 be utilized in vaccine development strategies?

L. monocytogenes has demonstrated potential as a live vaccine vector, making proteins like lmo2265 valuable components in vaccine development through several approaches:

Recombinant protein subunit vaccines:

  • Purified recombinant lmo2265 can be formulated with appropriate adjuvants

  • Multiple epitopes from different pathogens can be engineered into the lmo2265 scaffold

  • The protein can be incorporated into various delivery systems (liposomes, nanoparticles, virus-like particles)

L. monocytogenes as a vaccine vector:
L. monocytogenes has unique properties that make it valuable as a vaccine vector. It can enter the cytosol of host cells, allowing secreted proteins to efficiently access the endogenous antigen-processing pathway and presentation by MHC class I molecules . This capability has been exploited through:

  • Development of genetic systems for site-specific integration of antigen expression cassettes into the Listeria genome

  • Regulated expression and secretion of heterologous proteins

  • Induction of CD8+ T-cell-mediated protective immunity

Experimental vaccine development data:
Studies using recombinant L. monocytogenes as vaccine vectors have demonstrated promising results. In a lymphocytic choriomeningitis virus (LCMV) murine infection model, vaccination with recombinant Listeria strains expressing LCMV antigens induced LCMV-specific CD8+ T cells that protected mice against LCMV challenge . Similarly, in a cottontail rabbit papillomavirus model, recombinant Listeria strains stimulated protective antitumor immunity .

What are the considerations for optimizing immunogenicity of lmo2265-based vaccines?

When developing lmo2265-based vaccines, several factors must be considered to optimize immunogenicity:

Antigen design optimization:

  • Identify and preserve immunodominant epitopes within lmo2265

  • Consider fusion to molecular adjuvants (e.g., flagellin, heat-shock proteins)

  • Engineer modifications to enhance stability and presentation to the immune system

Delivery system selection:

Delivery SystemAdvantagesConsiderations
Attenuated L. monocytogenes vectorsNatural adjuvant properties; CD8+ T cell inductionSafety concerns; regulatory hurdles
Protein-adjuvant formulationsWell-established safety profile; controlled dosingMay require multiple doses
DNA vaccines encoding lmo2265Stable; relatively easy to produceGenerally lower immunogenicity in humans
mRNA vaccines encoding lmo2265Strong immune response; rapid productionCold chain requirements; potential reactogenicity

Safety considerations:

  • For live vectors, ensure adequate attenuation while maintaining immunogenicity

  • Monitor for potential autoimmune responses if lmo2265 shares homology with host proteins

  • Develop comprehensive toxicity profiles in relevant preclinical models

By systematically addressing these considerations, researchers can maximize the potential of lmo2265-based vaccines while ensuring their safety and efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.