Recombinant Listeria monocytogenes serovar 1/2a UPF0756 membrane protein lmo1568 (lmo1568)

Shipped with Ice Packs
In Stock
Cat. No.
BT2125176
Source
in vitro E.coli expression system
Synonyms
lmo1568; UPF0756 membrane protein lmo1568
Quick Inquiry

Description

Molecular Characterization

The lmo1568 protein is a membrane-associated polypeptide expressed in Listeria monocytogenes serovar 1/2a. Key features include:

PropertyDetails
UniProt IDQ8Y6W3
Amino Acid Sequence153 residues: MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHVDGKVMEIIQAKGINWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVDPQVTVSLVFG TILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK
Expression SystemEscherichia coli with N-terminal His-tag
Protein Purity>90% (SDS-PAGE)
Storage ConditionsLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -20°C/-80°C

Production and Optimization

Recombinant lmo1568 is produced via heterologous expression in E. coli, leveraging strains optimized for membrane protein synthesis (e.g., LEMO21(DE3)) to mitigate toxicity and aggregation . Key challenges and solutions include:

ChallengeSolution
Detergent CompatibilityUse of LMNG or DDM/CHS detergents for solubilization
Protein StabilityAddition of 50% glycerol and avoidance of repeated freeze-thaw cycles
Yield OptimizationTranscriptional tuning via L-rhamnose induction to balance expression levels

Functional Insights

While the exact biochemical role of lmo1568 remains uncharacterized, genomic context and homolog analyses provide clues:

  • Operon Association: The lmo1568 gene is part of an operon with citC and citZ, which are involved in citrate metabolism, suggesting a potential role in metabolic regulation .

  • Stress Response: Transcriptome studies of L. monocytogenes under acid stress show differential expression of σ<sup>B</sup>-regulated genes, though lmo1568 itself was not highlighted .

Pathogenesis Studies

As a membrane protein, lmo1568 is a candidate for investigating L. monocytogenes virulence mechanisms, particularly host-cell adhesion or immune evasion .

Immunological Reagents

Commercial suppliers offer lmo1568 as an ELISA-ready antigen for antibody development, priced at ~$2,765 (50 µg) .

Challenges and Future Directions

  • Functional Annotation: The lack of pathway or interaction data limits mechanistic understanding. Targeted knockouts or cryo-EM studies are needed .

  • Scale-Up: Low yields in E. coli necessitate strain engineering or alternative expression systems (e.g., insect cells) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lmo1568; UPF0756 membrane protein lmo1568
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Target Names
lmo1568
Target Protein Sequence
MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHVDGKVMEIIQAKGINWGVTIIT VAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVDPQVTVSLVFG TILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK
Uniprot No.
Q8Y6W3

Target Background

Database Links

KEGG: lmo:lmo1568

STRING: 169963.lmo1568

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.