Recombinant Listeria welshimeri serovar 6b ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; lwe2481; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
atpF
Target Protein Sequence
MLQPHLVIGSAFTFGDAFFTLFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEES RAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIA REKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, which houses the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links

KEGG: lwe:lwe2481

STRING: 386043.lwe2481

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Listeria welshimeri?

ATP synthase subunit b (atpF) in Listeria welshimeri is a critical component of the F0F1 ATP synthase complex, which plays a fundamental role in cellular energy production. This protein functions within the F0 sector of the ATP synthase, helping anchor the complex to the bacterial membrane and participating in the rotational mechanism that couples proton translocation to ATP synthesis. In L. welshimeri serovar 6b, atpF contains a characteristic nucleotide-binding site for ATP with the consensus sequence GPNGAGKST starting at position 33, corresponding to the canonical glycine-rich loop (GXXGXGKS/T) found in ATP-binding enzymes . Additionally, the protein contains a glutamine-glycine-rich motif (LSGGQLQR) that likely functions as a peptide linker joining different functional domains of the protein .

How does L. welshimeri atpF differ from homologous proteins in pathogenic Listeria species?

L. welshimeri, historically considered a non-pathogenic species, shows interesting distinctions in its atpF protein compared to pathogenic Listeria species such as L. monocytogenes. While the core ATP synthase functionality remains conserved, genomic analyses reveal specific adaptations. Unlike L. monocytogenes, L. welshimeri lacks the small RNA Rli27, which has important regulatory functions in pathogenic species . Sequence alignments of the genomic regions containing atpF and related regulatory elements show clear differences between L. welshimeri and pathogenic Listeria species . These distinctions may contribute to the traditionally non-pathogenic nature of L. welshimeri, although recent studies suggest this species may be acquiring virulence characteristics similar to pathogenic Listeria strains .

What is the significance of studying atpF in the context of Listeria species evolution?

Studying atpF in L. welshimeri provides valuable insights into bacterial evolution and adaptation. Recent genomic analyses have revealed that previously considered "harmless" Listeria species like L. welshimeri and L. innocua are developing resistance mechanisms and virulence factors similar to pathogenic L. monocytogenes . Whole genome sequencing studies have shown some L. welshimeri strains are developing resistance to environmental stresses including temperature, pH, and dehydration . The atpF gene, as part of the critical ATP synthesis machinery, may undergo selective pressure during this adaptive evolution. Comparing atpF sequences and functionality across Listeria species can help track evolutionary relationships and identify genomic changes associated with pathogenicity development.

What expression systems are most effective for recombinant L. welshimeri atpF?

For optimal expression of recombinant L. welshimeri atpF, several host systems have proven effective, with E. coli being the most commonly utilized. Based on experimental data, the following expression systems yield reliable results:

Expression SystemAdvantagesTypical YieldOptimal Induction
E. coliHigh yield, cost-effective, rapid growth>90% purity IPTG 0.5-1.0 mM, 16-18°C, 16-20 hours
YeastPost-translational modifications, proper folding70-85% purityGalactose 0.5-2%, 48-72 hours
BaculovirusComplex protein folding, higher molecular weight proteins75-80% purityMOI 2-5, 48-72 hours post-infection
Mammalian cellNative-like folding, full functionality60-75% purityDepends on vector system

When using E. coli expression systems, incorporating a polyhistidine tag facilitates purification while maintaining protein functionality. For optimal results, expression at lower temperatures (16-18°C) after induction reduces inclusion body formation and increases the yield of soluble protein .

What purification strategies yield the highest purity of recombinant atpF?

A multi-step purification approach is recommended to achieve >90% purity of recombinant L. welshimeri atpF . The following protocol has been optimized based on experimental data:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins

  • Intermediate purification: Ion exchange chromatography (typically anion exchange using Q-Sepharose)

  • Polishing step: Size exclusion chromatography using Superdex 75 or 200

Critical purification parameters include:

  • Maintaining 20-30 mM imidazole in binding buffer to reduce non-specific binding

  • Including 10% glycerol and 1-5 mM β-mercaptoethanol in all buffers to enhance protein stability

  • Performing all purification steps at 4°C to minimize proteolysis

  • Using EDTA-free protease inhibitor cocktail during initial lysis

This approach consistently yields atpF protein with >90% purity as confirmed by SDS-PAGE analysis .

How can I verify the functionality of purified recombinant atpF?

Functional verification of purified recombinant L. welshimeri atpF requires multiple complementary approaches:

  • ATP binding assay: Using fluorescent ATP analogs (e.g., TNP-ATP) to measure binding affinity and kinetics. The consensus nucleotide-binding site (GPNGAGKST) should demonstrate specific ATP binding .

  • ATP hydrolysis assay: Monitoring inorganic phosphate release using colorimetric methods (malachite green assay) or coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system).

  • Interaction studies: Electrophoretic mobility shift assays (EMSA) to evaluate interactions with other subunits or regulatory elements, similar to the approaches used to study interactions between Listeria small RNAs and their target proteins .

  • Reconstitution experiments: Incorporating purified atpF into proteoliposomes along with other ATP synthase components to assess ATP synthesis activity.

  • Thermal shift assays: To evaluate protein stability and proper folding under various buffer conditions.

A properly functional atpF protein should demonstrate specific ATP binding, contribute to ATP hydrolysis when reconstituted with other ATP synthase components, and show expected interaction patterns with other subunits of the complex.

Are there known regulatory small RNAs that interact with atpF in L. welshimeri?

Unlike L. monocytogenes and L. innocua, L. welshimeri lacks the regulatory small RNA Rli27, which is present in these other Listeria species . Sequence alignment analyses of the genomic regions from various Listeria species clearly demonstrate the absence of Rli27 in L. welshimeri, while this sRNA is conserved in L. monocytogenes and L. innocua . This absence suggests potentially different regulatory mechanisms for ATP synthase components in L. welshimeri compared to pathogenic Listeria species.

For researchers interested in studying potential atpF regulation in L. welshimeri, EMSA (Electrophoretic Mobility Shift Assays) protocols similar to those used for studying Rli27 interactions can be adapted. These typically involve:

  • In vitro transcription of potential regulatory RNAs

  • Incubation with the atpF mRNA or protein in binding buffer (20 mM Tris-acetate pH 7.6, 100 mM sodium acetate, 5 mM magnesium acetate, 20 mM EDTA) at 37°C for 1 hour

  • Analysis on native 4% polyacrylamide gels in 0.5× TBE buffer at 200V, 4°C

  • Visualization using nucleic acid stains such as Gel Red

How does atpF contribute to ATP synthesis in L. welshimeri?

The atpF protein (ATP synthase subunit b) plays a crucial structural and functional role in the F0F1 ATP synthase complex of L. welshimeri. Based on comparative analyses with other bacterial ATP synthases, the protein fulfills several key functions:

  • Structural support: Forms part of the peripheral stalk that connects the F1 catalytic domain to the F0 membrane domain

  • Energy coupling: Participates in the mechanical energy transfer from proton translocation to ATP synthesis

  • Stabilization: Helps counteract the torque generated during ATP synthesis to prevent rotation of the entire complex

The consensus ATP-binding site (GPNGAGKST) starting at position 33 and the glutamine-glycine-rich motif (LSGGQLQR) are critical for these functions . The ATP-binding domain corresponds to the canonical glycine-rich loop (GXXGXGKS/T) found in various ATP-binding enzymes and is essential for the protein's role in energy transduction .

What protein-protein interactions are critical for atpF function?

Critical protein-protein interactions involving atpF include:

Interaction PartnerInteraction RegionFunctional Significance
ATP synthase δ subunitC-terminal domain of atpFConnects peripheral stalk to F1 sector
ATP synthase α subunitMiddle region of atpFStabilizes the catalytic assembly
ATP synthase a subunitN-terminal domain of atpFAnchors peripheral stalk to membrane portion
ATP synthase c-ringTransmembrane domainCouples proton movement to rotation

These interactions can be studied using various methods including crosslinking experiments, co-immunoprecipitation, surface plasmon resonance, and FRET analyses. When designing experiments to study these interactions, it's important to preserve the native conformation of atpF, which often requires the inclusion of detergents or lipid nanodiscs in the experimental setup.

How are L. welshimeri strains evolving regarding antibiotic resistance and virulence?

Recent research has revealed concerning evolutionary trends in previously "harmless" Listeria species including L. welshimeri. Whole genome sequencing studies in South Africa have shown that some L. welshimeri strains are developing resistance to environmental stresses including temperature, pH, and dehydration . More concerning is evidence that these strains are acquiring hypervirulence characteristics genetically identical to those found in pathogenic L. monocytogenes .

Specific resistance mechanisms observed include:

  • Development of all three genes for resistance to Benzalkonium chloride, a widely used disinfectant in food processing industry

  • Acquisition of stress response systems similar to pathogenic Listeria species

  • Potential development of antibiotic resistance traits through horizontal gene transfer

These findings suggest that ATP synthase components including atpF may be under selective pressure as these bacteria adapt to new environmental challenges. Researchers should be aware of potential strain-specific variations in atpF sequence and function that may correlate with these emerging resistance patterns.

Can recombinant L. welshimeri atpF be used in structural biology studies?

Recombinant L. welshimeri atpF is highly suitable for structural biology studies due to its stability and ability to be expressed at high yields (>90% purity) . The following approaches have proven successful:

The presence of defined functional motifs, including the ATP-binding domain and the glutamine-glycine-rich linker region, makes atpF particularly valuable for structure-function relationship studies .

What is the potential of L. welshimeri as a non-pathogenic vector for vaccine development?

  • Enhanced safety profile: L. welshimeri lacks many virulence factors found in L. monocytogenes, potentially offering a safer vaccine platform

  • Reduced pre-existing immunity: Unlike L. monocytogenes, which may encounter pre-existing immunity in some populations, L. welshimeri may avoid such limitations

  • Customizable immunogenicity: Engineered L. welshimeri expressing recombinant antigens may elicit targeted immune responses without excessive inflammation

Research on L. monocytogenes vaccine vectors has demonstrated robust systemic and mucosal immune responses after intranasal vaccination, eliciting strong IFN-γ+ cellular responses and secretory IgA production . Similar approaches could be adapted for L. welshimeri, potentially using atpF fusion constructs as part of the vaccine design. The relatively conserved nature of atpF could be leveraged to create stable expression platforms for various antigens.

What are common challenges in expressing recombinant L. welshimeri atpF?

Researchers frequently encounter several challenges when expressing recombinant L. welshimeri atpF:

ChallengeLikely CauseRecommended Solution
Low expression yieldCodon bias, toxic effectsOptimize codon usage, use lower induction temperature (16-18°C), employ tightly regulated promoters
Inclusion body formationRapid overexpression, improper foldingExpress at lower temperatures, use solubility-enhancing tags (SUMO, MBP), co-express with chaperones
Protein instabilityProteolytic degradation, aggregationInclude protease inhibitors, maintain glycerol (10-15%) in all buffers, avoid freeze-thaw cycles
Loss of activityImproper folding, loss of cofactorsVerify nucleotide-binding site integrity, include appropriate metal ions during purification
Contaminating proteinsNon-specific binding, truncated productsIncrease imidazole in wash buffers, include multiple purification steps

For optimal results, expression in E. coli at lower temperatures (16-18°C) after induction with reduced IPTG concentration (0.1-0.5 mM) often produces the best balance between yield and protein quality .

How can protein aggregation issues be addressed when working with recombinant atpF?

Aggregation is a common challenge when working with membrane-associated proteins like atpF. Effective strategies to minimize aggregation include:

  • Buffer optimization:

    • Include 10-15% glycerol in all buffers to enhance stability

    • Maintain pH between 7.0-8.0 to minimize charge-based aggregation

    • Add low concentrations (1-5 mM) of reducing agents such as DTT or β-mercaptoethanol

  • Additive screening:

    • Non-ionic detergents (0.05-0.1% Triton X-100 or 0.01-0.05% DDM)

    • Amino acid additives (50-100 mM arginine or proline)

    • Osmolytes (0.5-1 M trehalose or sucrose)

  • Purification modifications:

    • Perform all steps at 4°C

    • Use gradient elution rather than step elution

    • Include centrifugation steps (100,000 × g for 30 minutes) before column chromatography to remove pre-formed aggregates

  • Storage conditions:

    • Store at -20°C with glycerol (>20%) for extended storage or -80°C for maximum stability

    • Avoid repeated freeze-thaw cycles by preparing small aliquots

Performing dynamic light scattering analysis before and after implementing these strategies can help quantify their effectiveness in reducing aggregation.

What quality control measures ensure reproducible results with recombinant atpF?

To ensure reproducible results with recombinant L. welshimeri atpF, implement the following quality control measures:

  • Protein purity assessment:

    • SDS-PAGE analysis with Coomassie staining (target >90% purity)

    • Western blot confirmation using anti-His antibodies or specific anti-atpF antibodies

    • Mass spectrometry to confirm protein identity and detect potential modifications

  • Functional verification:

    • ATP binding assays to confirm the functionality of the nucleotide-binding domain

    • Circular dichroism spectroscopy to verify proper secondary structure content

    • Thermal shift assays to assess protein stability and batch-to-batch consistency

  • Contamination screening:

    • Endotoxin testing, particularly important for immunological applications

    • Nuclease assays to ensure absence of nucleic acid contamination

    • Microbial contamination testing for long-term storage stocks

  • Documentation and standardization:

    • Detailed batch records including expression conditions, purification parameters, and storage data

    • Standard reference samples for comparison between batches

    • Established acceptance criteria for each quality parameter

Implementing these measures helps ensure that experimental outcomes are due to genuine biological effects rather than variations in protein quality or preparation methods.

How might the study of L. welshimeri atpF contribute to understanding bacterial evolution and pathogenicity?

The study of L. welshimeri atpF offers several promising avenues for understanding bacterial evolution and emerging pathogenicity:

  • Evolutionary adaptation markers: Comparing atpF sequences across Listeria species and strains can reveal evolutionary pressures and adaptation signatures. With evidence that L. welshimeri is acquiring virulence characteristics , atpF modifications may correlate with these changes and serve as molecular markers for evolving pathogenicity.

  • Energy metabolism and virulence: Investigating how energy production via ATP synthase influences the acquisition of virulence traits could reveal fundamental connections between metabolic adaptation and pathogenicity. The specific nucleotide-binding site in atpF (GPNGAGKST) may undergo selection during this process.

  • Horizontal gene transfer mapping: Analyzing atpF and surrounding genomic regions could help track horizontal gene transfer events that contribute to the spread of resistance and virulence genes among previously non-pathogenic Listeria species.

  • Structural biology insights: Comparative structural studies of atpF across pathogenic and non-pathogenic Listeria species may reveal adaptations in protein-protein interactions that correlate with virulence potential.

These research directions could ultimately contribute to better prediction models for emerging pathogens and inform surveillance strategies for monitoring potential threats in food and environmental samples.

What novel applications might emerge from structural and functional studies of L. welshimeri atpF?

Structural and functional studies of L. welshimeri atpF could lead to several innovative applications:

  • Antimicrobial development: The ATP synthase complex is an emerging target for antimicrobial development. Detailed structural knowledge of L. welshimeri atpF could facilitate the design of specific inhibitors that target Listeria species while sparing beneficial bacteria.

  • Biotechnological applications: Engineered atpF variants could be developed for:

    • Biosensors that detect ATP levels or energy state changes

    • Synthetic biology platforms for energy production optimization

    • Protein scaffolds for nanobiotechnology applications

  • Vaccine technology: Understanding atpF structure and function could inform the development of non-pathogenic L. welshimeri as vaccine vectors, similar to attenuated L. monocytogenes strains that have shown promising results in eliciting robust immune responses .

  • Diagnostic markers: Specific signatures in atpF could serve as diagnostic markers to identify emerging virulent strains of traditionally non-pathogenic Listeria species, supporting food safety monitoring.

These applications highlight the potential translational value of fundamental research on bacterial ATP synthase components like atpF.

How might comparative studies between Listeria species inform our understanding of bacterial bioenergetics?

Comparative studies of ATP synthase components, including atpF, across Listeria species offer valuable insights into bacterial bioenergetics:

  • Adaptation mechanisms: Different Listeria species inhabit diverse ecological niches with varying energy availability. Comparing atpF across species can reveal adaptations in ATP synthesis efficiency that correspond to these different energetic constraints.

  • Regulatory network evolution: The absence of regulatory elements like Rli27 in L. welshimeri, which is present in L. monocytogenes and L. innocua , suggests divergent regulatory networks for energy metabolism. Exploring these differences can illuminate how regulatory networks evolve alongside core metabolic machinery.

  • Structure-function relationships: By comparing the conserved nucleotide-binding site (GPNGAGKST) and other functional domains across species, researchers can identify essential features versus adaptable regions of atpF.

  • Energy coupling mechanisms: Differences in how energy is coupled between proton translocation and ATP synthesis across Listeria species may reveal fundamental principles about the efficiency and regulation of this critical process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.