Recombinant Listeria welshimeri serovar 6b Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls; lwe2451; Cardiolipin synthase; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
cls
Target Protein Sequence
MGLLAYLLVVLLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDSNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDISYIGGFNI GDEYLGLSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTNKIDYKPRYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links

KEGG: lwe:lwe2451

STRING: 386043.lwe2451

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what is its role in Listeria welshimeri?

Cardiolipin synthase (cls) is an enzyme responsible for the biosynthesis of cardiolipin (CL), a phospholipid that constitutes a significant portion of bacterial membranes. In Listeria species, cardiolipin typically accounts for approximately 48.5% of membrane phospholipids, as observed in the related species L. monocytogenes . The enzyme catalyzes the condensation reaction that forms cardiolipin from precursor phospholipids. While specific data on L. welshimeri cls is limited, comparative studies with other Listeria species and bacteria like E. coli provide insights into its likely structure and function. In bacteria, cardiolipin plays crucial roles in membrane stability, energy metabolism, and adaptation to environmental stresses.

How does cardiolipin synthase in L. welshimeri compare to other Listeria species?

L. welshimeri cardiolipin synthase shares structural similarities with other Listeria species but exhibits distinctive characteristics. Comparative genomic analyses have shown that L. welshimeri lacks several pathogenicity islands (LIPI-1 to LIPI-4) found in other Listeria species . This genomic difference may affect the regulation and function of metabolic enzymes, including cardiolipin synthase. The non-pathogenic nature of L. welshimeri makes it an attractive model organism for studying fundamental aspects of Listeria biology without the complications of virulence factors. Sequence alignment studies would reveal specific amino acid differences in the catalytic domains of cls enzymes across Listeria species, potentially correlating with functional variations.

What are the optimal expression systems for recombinant L. welshimeri cardiolipin synthase?

For expression of recombinant L. welshimeri serovar 6b cardiolipin synthase, E. coli-based expression systems are commonly employed due to their efficiency and scalability. Based on methodologies used for similar enzymes, the following approaches are recommended:

  • Vector selection: pBAD30 or similar arabinose-inducible vectors have proven effective for expressing cardiolipin synthases, as demonstrated with E. coli cls genes .

  • Expression conditions: Optimal expression typically occurs at lower temperatures (16-25°C) to enhance proper folding of membrane-associated enzymes.

  • Induction parameters: Using 0.2% arabinose for induction, as employed for E. coli cls genes, provides a starting point for optimization .

  • Codon optimization: Adapting the L. welshimeri cls gene codons for E. coli expression can significantly improve yield.

It's important to note that membrane-associated enzymes like cardiolipin synthase may require special considerations for solubilization and purification, potentially necessitating detergent screening or membrane fraction isolation.

How can researchers assess the activity of recombinant L. welshimeri cardiolipin synthase?

Assessment of recombinant L. welshimeri cls activity can be performed using several complementary approaches:

  • Thin-layer chromatography (TLC): Lipids can be extracted from bacterial cultures expressing the recombinant enzyme and separated by TLC using chloroform-methanol-acetic acid-water (50:25:6:2, vol/vol/vol/vol) as the solvent system . Visualization can be achieved using iodine, phosphomolybdenum blue, or copper sulfate .

  • Mass spectrometry analysis: LC/MS/MS provides sensitive detection of cardiolipin production, especially useful when enzyme activity is low . This technique can detect cardiolipin even when not visible by TLC charring methods.

  • Complementation assays: Expression of L. welshimeri cls in cls-deficient mutants (such as E. coli ΔclsABC) can demonstrate functional activity through restoration of cardiolipin production .

  • In vitro enzyme assays: Using purified enzyme with appropriate phospholipid substrates and monitoring product formation by TLC or mass spectrometry.

Each method offers different advantages, with TLC providing a relatively simple screening approach and mass spectrometry offering greater sensitivity and specificity.

How do cardiolipin synthase genes differ among Listeria species and what are the evolutionary implications?

Cardiolipin synthase genes show notable variations across Listeria species, reflecting their evolutionary adaptation to different ecological niches:

Listeria SpeciesCls Gene FeaturesAssociated Genetic ElementsEvolutionary Implications
L. welshimeriLacks virulence-associated genomic islandsAbsence of LIPI-1 to LIPI-4 Adapted to non-pathogenic lifestyle
L. innocuaMay contain LIPI-3 and LIPI-4 More resistance genes than L. welshimeri Intermediate evolutionary position
L. monocytogenesContains LIPI-1 in 7.4% of isolates Contains internalin gene family (inlABCEFJK) Adaptation to pathogenic lifestyle

How does L. welshimeri cardiolipin synthase relate to the phospholipase D superfamily?

Based on comparative analysis with E. coli cls enzymes, L. welshimeri cardiolipin synthase likely belongs to the phospholipase D superfamily. In E. coli, all three identified cardiolipin synthases (ClsA, ClsB, and ClsC) share sequence homology and belong to this superfamily . This classification has important implications for understanding the catalytic mechanism of L. welshimeri cls:

  • Catalytic motif: The enzyme likely contains the characteristic HxK(x)4D(x)6GSxN motif essential for catalytic activity .

  • Mechanism: The reaction likely proceeds via a phosphatidyl-enzyme intermediate, similar to other phospholipase D superfamily members.

  • Structure-function relationship: Mutations in the putative catalytic motif would be expected to prevent cardiolipin formation, as demonstrated with E. coli ClsC .

  • Evolutionary conservation: The structural conservation across bacterial species suggests fundamental importance of the phospholipase D fold for cardiolipin synthesis.

Further structural studies would be needed to confirm these predictions and identify any unique features of the L. welshimeri enzyme.

How does cardiolipin contribute to L. welshimeri adaptation to environmental stresses?

Cardiolipin plays a critical role in bacterial adaptation to environmental stresses, particularly in Listeria species:

  • Cold adaptation: In Listeria, cardiolipin composition changes in response to cold temperatures, with a significant shift in fatty acid composition. Cold-grown cells show increased proportions of anteiso-15:0 fatty acids and decreased anteiso-17:0 fatty acids compared to those grown at higher temperatures . This modification alters membrane fluidity to maintain functionality at lower temperatures.

  • Osmotic stress response: Cardiolipin synthesis increases with rising medium osmolarity during both logarithmic growth and stationary phase . This adaptation helps maintain membrane integrity under osmotic challenge.

  • Growth phase regulation: Cardiolipin production varies by growth phase, with different cls enzymes contributing differentially depending on growth stage. In E. coli, ClsA is active at low osmolarity during logarithmic growth, while other cls enzymes become more important in stationary phase .

These adaptive responses likely apply to L. welshimeri, although species-specific variations may exist based on its non-pathogenic lifestyle and distinct ecological niche.

What factors regulate cardiolipin synthase expression and activity in L. welshimeri?

The regulation of cardiolipin synthase in L. welshimeri involves multiple factors at transcriptional, translational, and post-translational levels:

Experimental confirmation of these regulatory mechanisms specifically in L. welshimeri would require targeted studies of gene expression patterns under various conditions.

How can recombinant L. welshimeri cardiolipin synthase be utilized in biotechnological applications?

Recombinant L. welshimeri cardiolipin synthase offers several potential biotechnological applications:

  • Biocatalysis: The enzyme can catalyze the production of cardiolipin and cardiolipin derivatives for research and pharmaceutical applications. The non-pathogenic nature of L. welshimeri makes its enzymes potentially safer for industrial use compared to those from pathogenic Listeria species.

  • Membrane engineering: Recombinant cls can be used to modify phospholipid composition in synthetic membranes or liposomes, creating customized membrane systems with desired properties.

  • Synthetic biology platforms: The enzyme can be incorporated into synthetic biology circuits designed to respond to environmental stresses by modifying membrane composition.

  • Screening platform for antimicrobial compounds: Since cardiolipin is essential for bacterial membrane function, the recombinant enzyme system could serve as a target for screening potential antimicrobial compounds that inhibit cardiolipin synthesis.

  • Comparative enzymology: The study of L. welshimeri cls alongside enzymes from pathogenic Listeria species could reveal molecular determinants of host adaptation and pathogenicity related to membrane composition.

Each application would require specific optimization of the recombinant expression system and activity assays tailored to the intended use.

What are the current challenges in structure-function analysis of L. welshimeri cardiolipin synthase?

Structure-function analysis of L. welshimeri cardiolipin synthase faces several significant challenges:

  • Membrane protein crystallization: As a membrane-associated enzyme, obtaining crystal structures is technically challenging due to hydrophobicity and stability issues.

  • Substrate specificity determination: Defining the exact substrate preference requires systematic testing with various phospholipids. In E. coli, three distinct cls enzymes with different substrate preferences have been identified . Determining whether L. welshimeri possesses multiple cls enzymes with different specificities adds complexity.

  • Catalytic mechanism elucidation: The precise mechanism, including identification of catalytic residues and reaction intermediates, requires sophisticated biochemical and biophysical approaches.

  • Co-factor identification: Potential co-factors or accessory proteins that enhance activity, similar to the YmdB protein for E. coli ClsC , need to be identified and characterized.

  • Physiological regulation: Understanding the complex regulation of cls activity in response to environmental conditions requires integration of genomic, transcriptomic, and proteomic approaches.

Addressing these challenges requires multidisciplinary approaches combining molecular biology, biochemistry, structural biology, and systems biology methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.