Recombinant Listeria welshimeri serovar 6b Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; lwe2084; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
mscL
Target Protein Sequence
MKKMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVDNIIMPVVGVLLGGLDFTKLSV TVGKSVIQYGAFIQSIVDFIIIAFAIFIFVKILTSFMKKKEQPVEETPVPPTEEYLKEIR DLLKEQQKEI
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links

KEGG: lwe:lwe2084

STRING: 386043.lwe2084

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key characteristics of Listeria welshimeri serovar 6b?

Listeria welshimeri serovar 6b (strain SLCC5334, CIP8149, Welshimer V8) was originally isolated from decaying plant material . It belongs to a non-pathogenic Listeria species characterized by several distinctive features:

  • Small (0.5 to 2.0 μm), non-spore-forming, gram-positive rod-shaped bacteria

  • Motile below 30°C using peritrichous flagella

  • Capable of growth at low temperatures (4°C) within 5 days

  • Negative results in CAMP tests with Staphylococcus aureus and Rhodococcus equi

  • Negative for oxidase activity but positive for catalase activity

  • Produces acid from fermentation of d-xylose and α-methyl-d-mannoside

  • Does not produce acid from l-rhamnose and d-mannitol

Unlike pathogenic Listeria species, L. welshimeri lacks the virulence gene cluster (vgc) or Listeria pathogenicity island 1 (LIPI-1) responsible for the intracellular life cycle typical of pathogenic Listeria . Consequently, L. welshimeri strains are non-hemolytic and non-pathogenic, with even high doses (>1 × 10^8 CFU/ml) being non-lethal in mouse models, compared to the lethal dose of L. monocytogenes (1 × 10^3 CFU/ml) .

How do large-conductance mechanosensitive channels function in bacterial systems?

The mechanosensitive channel of large conductance (MscL) functions as a molecular safety valve that responds directly to membrane tension. The channel operates through the following mechanism:

  • MscL is gated by tension transmitted through the lipid bilayer, with a steep sigmoidal dependence on tension

  • The midpoint of channel opening (T1/2) occurs at approximately 11.8 dyn/cm

  • The energy difference between closed and fully open states in unstressed membranes is approximately 18.6 kBT

  • MscL is not a simple binary channel but rather exhibits at least four conducting states plus a closed state

  • The conformational change from closed to fully open involves an in-plane area change of approximately 6 nm²

These properties make MscL an ideal model system for studying mechanosensation, as its response to membrane tension is direct and does not involve other cellular components, allowing for reconstitution studies in artificial lipid systems.

What experimental systems are available for studying recombinant MscL?

Several experimental systems have been developed for studying recombinant MscL:

  • Liposome reconstitution: Purified MscL can be reconstituted into liposomes for patch-clamp electrophysiology, enabling precise measurement of channel properties in response to defined membrane tensions .

  • Bacterial expression systems: MscL-GFP fusion proteins have been successfully expressed in bacterial cells, allowing visualization of the channel in living bacteria using confocal microscopy .

  • Mammalian neuronal networks: Heterologous expression of engineered bacterial MscL has been achieved in mammalian neuronal networks, offering a system to study mechano-sensitization of neuronal circuits .

  • In vivo rapid assays: Functional assessment of MscL variants with post-translational modifications can be performed using rapid in vivo assays, particularly useful for studying protein-lipid interactions .

Each system offers distinct advantages depending on the research questions being addressed, from biophysical characterization to cellular localization studies.

What are the recommended protocols for isolating and identifying L. welshimeri from environmental samples?

Isolation and identification of L. welshimeri from environmental samples requires a systematic approach:

Isolation Protocol:

  • Collect environmental samples (particularly decaying plant material) using sterile techniques

  • Homogenize samples in buffered peptone water

  • Apply selective enrichment using either:

    • U.S. FDA Bacteriological Analytical Manual (BAM) method

    • Cold enrichment (4°C) technique for 1-2 weeks

  • Plate on selective media (e.g., Oxford or PALCAM agar)

  • Incubate at 30°C for 24-48 hours

Identification Methods:

  • Biochemical profiling: Test for acid production from d-xylose and α-methyl-d-mannoside (positive) and l-rhamnose and d-mannitol (negative)

  • PCR-based identification: Use species-specific primers targeting conserved regions

  • Whole genome sequencing: For definitive identification and serovar determination

The reliable identification of L. welshimeri can be complicated by the presence of other Listeria species. Research shows that in food samples containing multiple Listeria species, L. welshimeri can inhibit the recovery of pathogenic L. monocytogenes in three out of four food matrices tested, with population differentials as large as 3.7 ± 0.2 logs . This competitive effect must be considered when developing isolation protocols.

What methods are effective for recombinant expression and purification of MscL?

Recombinant expression and purification of MscL requires careful optimization:

Expression Systems:

  • E. coli-based expression: Most commonly used, typically with a pET vector system and BL21(DE3) strain

  • Cell-free expression systems: For difficult-to-express variants

  • Codon optimization: Essential for heterologous expression, especially for L. welshimeri genes in E. coli

Purification Protocol:

  • Cell lysis via French press or sonication in buffer containing appropriate detergents (typically n-dodecyl-β-D-maltopyranoside or n-octyl-β-D-glucopyranoside)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using selected detergents

  • Affinity chromatography (typically using His-tagged constructs)

  • Size exclusion chromatography for further purification

Quality Control Assessments:

  • SDS-PAGE and Western blotting for purity and identity verification

  • Mass spectrometry for protein identification

  • Circular dichroism to confirm proper secondary structure (MscL is highly helical)

  • Functional reconstitution in liposomes followed by patch-clamp analysis

The purification process must carefully maintain the native structure of MscL, as improper folding can significantly affect mechanosensitive properties.

What approaches can be used to study MscL localization in cellular systems?

Several complementary approaches can be employed to study MscL localization:

Genetic Fusion Methods:

  • MscL-GFP fusion proteins: These constructs allow visualization of MscL in living bacteria using confocal microscopy. Research has confirmed that properly constructed MscL-GFP fusions localize to the cytoplasmic membrane and form functional channels, although they may require more pressure to open compared to wild-type MscL .

  • PhoA-fusion experiments: These can determine membrane topology, indicating that MscL spans the membrane twice with both termini in the cytoplasm .

Imaging Techniques:

  • Confocal microscopy: Provides high-resolution images of MscL distribution in living cells

  • Super-resolution microscopy: Offers nanoscale resolution of protein clustering patterns

  • Electron microscopy: For ultrastructural localization studies

  • FRET-based approaches: For studying protein-protein interactions involving MscL

Quantitative Analysis:

  • Time-lapse imaging to track dynamic redistribution

  • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

  • Single-particle tracking for detailed diffusion analysis

These approaches collectively provide comprehensive information about MscL distribution, dynamics, and interactions in cellular contexts.

How do the mechanosensitive properties of L. welshimeri MscL compare to other bacterial species?

While specific comparative data for L. welshimeri MscL is limited in the provided search results, general principles of MscL comparison include:

Key Parameters for Comparison:

  • Gating threshold: The tension at which the channel opens (T1/2)

  • Sensitivity slope: How steeply channel open probability increases with tension

  • Conductance levels: Number and magnitude of subconductance states

  • Free energy difference: Between closed and open states in unstressed membranes

  • In-plane area change: During the gating transition

Expected Variation Factors:

  • Sequence conservation: Highly conserved domains likely maintain similar mechanosensitive properties

  • Membrane environment adaptation: Species-specific adaptations to native membrane composition

  • Environmental niche influence: Adaptations reflecting ecological niche (e.g., soil vs. decaying plant material)

A comprehensive comparison would require heterologous expression, purification, and patch-clamp analysis of MscL from multiple species under identical conditions. Current research on E. coli MscL indicates a midpoint tension (T1/2) of 11.8 dyn/cm with a slope sensitivity of 0.63 dyn/cm per e-fold change in open probability . These values could serve as reference points for characterizing L. welshimeri MscL.

What role does protein-lipid interaction play in MscL gating mechanisms?

Protein-lipid interactions are critical for MscL function, as demonstrated by several key findings:

  • Lipid bilayer as force transducer: The lipid bilayer directly transmits tension to the MscL protein, acting as the primary force transducer in mechanosensation .

  • Critical lipid interaction regions: Research has identified specific regions just distal to the cytoplasmic end of the second transmembrane helix that interact with membrane lipids and are crucial for channel gating .

  • Membrane anchor function: These lipid-interacting regions appear to act as anchors for the transmembrane domain tilting that occurs during the gating process .

  • Conservation of lipid interaction motifs: The presence of analogous lipid-interacting motifs across many different channels suggests a conserved protein-lipid dynamic mechanism .

  • Experimental validation methods: Multiple approaches have confirmed the importance of these interactions:

    • In vivo functional assays with post-translational modifications

    • Site-directed mutagenesis

    • Single-channel analyses

    • Tryptophan fluorescence measurements

Understanding these protein-lipid interactions is essential for developing a complete model of MscL gating and could inform the design of engineered channels with modified properties.

What challenges arise in heterologous expression systems for recombinant MscL?

Heterologous expression of recombinant MscL presents several challenges:

Expression System Challenges:

  • Membrane protein overexpression toxicity: High-level expression of membrane proteins like MscL can stress host cells

  • Proper membrane targeting: Ensuring efficient translocation to and insertion into the host membrane

  • Post-translational modifications: Differences between native and heterologous systems

  • Protein folding: Maintaining proper folding in non-native lipid environments

Functional Assessment Challenges:

  • Background mechanosensitive activity: Host cells may contain endogenous mechanosensitive channels

  • Altered biophysical properties: Changes in gating parameters when expressed in non-native membranes

  • Potential for misassembly: Incorrect oligomerization in heterologous systems

Solution Strategies:

  • Use of inducible expression systems with tight regulation

  • Co-expression of chaperones to assist proper folding

  • Fusion with fluorescent tags for localization and expression level monitoring

  • Membrane composition modifications to better match the native environment

  • Complementation assays in MscL-deficient strains to confirm functionality

When expressing L. welshimeri MscL in heterologous systems, these challenges need to be systematically addressed to ensure the recombinant channel retains its native properties.

What structural features differentiate MscL across bacterial species?

Structural analyses of MscL from different bacterial species reveal both conserved elements and species-specific variations:

Conserved Structural Elements:

  • Transmembrane topology: MscL typically spans the membrane twice with both termini in the cytoplasm

  • Secondary structure: High α-helical content across all species

  • Oligomerization state: Evidence suggests a homo-hexameric assembly for the active channel complex

  • Lipid-interacting domains: Critical regions for tension sensing

Variable Features:

  • Sequence divergence in loop regions: Particularly in the periplasmic and cytoplasmic loops

  • Channel conductance variations: Different subconductance states

  • Species-specific tension sensitivity: Variations in the tension required for channel opening

  • Molecular adaptations: Reflecting the native membrane environment

To comprehensively compare L. welshimeri MscL with better-studied variants like E. coli MscL, researchers should consider employing:

  • Comparative sequence analysis

  • Homology modeling

  • Cross-species chimeric channel construction

  • Electrophysiological comparison in identical membrane environments

How can patch-clamp techniques be optimized for studying recombinant MscL?

Patch-clamp optimization for MscL studies requires attention to several critical factors:

Sample Preparation:

  • Liposome composition: Use defined lipid compositions that provide optimal membrane fluidity and tension sensitivity

  • Protein-to-lipid ratio: Typically 1:1000 to 1:10000 weight ratio for single-channel recordings

  • Liposome size: Giant liposomes (>10 μm) are optimal for patch formation

Recording Configuration:

  • Excised inside-out patch: Most common configuration for controlled application of negative pressure

  • Calculation of membrane tension: Apply the formula T = (P × r)/2, where P is the pressure gradient and r is the radius of curvature measured by video microscopy

Signal Optimization:

  • Pipette solution: Typically 200-400 mM KCl, 90 mM MgCl2, 10 mM CaCl2, 5 mM HEPES (pH 7.2)

  • Bath solution: Similar ionic composition but with lower KCl (100-200 mM)

  • Voltage protocol: Hold at -20 to +20 mV for optimal signal-to-noise ratio

  • Sampling rate: Minimum 10 kHz with 2-5 kHz filtering

Data Analysis Parameters:

  • Pressure-response curves: Plot open probability (Po) versus membrane tension

  • Determination of midpoint tension (T1/2): The tension at which Po = 0.5

  • Calculation of slope sensitivity: Expressed as dyn/cm per e-fold change in Po/Pc

  • Energy difference calculation: Calculate ΔE from T1/2 and slope

With E. coli MscL, analyses have shown a steep sigmoidal dependence of Po on tension, with T1/2 = 11.8 dyn/cm and slope sensitivity of 0.63 dyn/cm per e-fold change . These parameters serve as valuable reference points for characterizing L. welshimeri MscL.

What are the critical residues for MscL mechanosensitivity and how can they be identified?

Identifying critical residues for MscL mechanosensitivity involves a systematic approach:

Identification Methods:

  • Alanine scanning mutagenesis: Systematic replacement of residues with alanine to identify functional impacts

  • Conservative/non-conservative substitutions: To determine the physicochemical properties required at each position

  • Cross-linking studies: To identify residues that change proximity during gating

  • Site-directed spin labeling: For electron paramagnetic resonance (EPR) spectroscopy

Key Functional Regions:

  • Transmembrane domains: Critical for sensing membrane tension and undergoing conformational changes

  • Lipid-interacting residues: Particularly in regions just distal to the cytoplasmic end of the second transmembrane helix

  • Pore-lining residues: Determining conductance properties and ion selectivity

  • Interfacial residues: Mediating subunit interactions within the oligomeric complex

Experimental Assessment Approaches:

  • Patch-clamp analysis: To determine changes in gating parameters (T1/2, slope sensitivity)

  • In vivo functional assays: Complementation of MscL-deficient strains

  • Post-translational modification: Using various probes with different affinities for the membrane environment

  • Tryptophan fluorescence measurements: To assess changes in residue environment during gating

Research has identified several residues that, when deleted or substituted, significantly affect channel kinetics or mechanosensitivity . For L. welshimeri MscL, comparative analysis with better-characterized homologs can guide targeted investigation of potentially critical residues.

How might recombinant L. welshimeri MscL be utilized in synthetic biology applications?

Recombinant L. welshimeri MscL offers several promising applications in synthetic biology:

Biosensor Development:

  • Mechanosensitive reporters: Engineering cells to respond to mechanical stimuli through MscL-coupled reporter systems

  • Osmotic stress detectors: Monitoring environmental osmotic changes through MscL activation

  • Membrane tension probes: Creating cellular biosensors for membrane physical properties

Controlled Release Systems:

  • Engineered liposomes: Development of tension-responsive liposomes for targeted drug delivery

  • Cell-based delivery platforms: Using MscL-expressing cells for controlled release of bioactive compounds

Neural Engineering:

  • Mechano-sensitization of neuronal networks: Heterologous expression of MscL in mammalian neurons enables mechanical stimulation of specific neuronal circuits

  • Non-invasive neuromodulation tools: Potential for developing new cell-type-specific stimulation approaches using mechanical stimuli

Advantages of L. welshimeri MscL:

  • Non-pathogenic origin: Enhanced biosafety profile compared to channels from pathogenic species

  • Evolutionary insights: As a non-pathogenic Listeria species that evolved from pathogenic ancestors , L. welshimeri MscL may offer unique structural or functional properties

These applications leverage the "pure mechanosensitivity" of engineered MscL, with its wide genetic modification library making it a versatile tool for developing mechano-genetic approaches .

How is the emergence of antimicrobial resistance affecting research on Listeria species?

Antimicrobial resistance is significantly impacting Listeria research in several ways:

Cross-species Resistance Transfer:

  • Research indicates that not only are pathogenic bacteria developing resistance, but previously "harmless" bacteria like Listeria innocua and Listeria welshimeri are adapting potentially harmful characteristics .

  • Whole genome analysis has shown that some L. innocua strains are developing resistance to temperature, pH, dehydration, and other stresses, as well as acquiring hypervirulence genes genetically identical to those in L. monocytogenes .

Disinfectant Resistance:

  • Some strains of L. innocua and L. welshimeri have developed all three genes for resistance to Benzalkon, a widely used disinfectant in the food processing industry .

  • This resistance development in non-pathogenic species raises concerns about potential gene transfer to pathogenic Listeria species.

Research Implications:

  • Increased biosafety considerations: Even when working with traditionally non-pathogenic species

  • Enhanced monitoring requirements: Regular assessment of resistance profiles

  • Evolution tracking: Closer monitoring of genetic exchanges between pathogenic and non-pathogenic Listeria species

  • Alternative control strategies: Development of new approaches to control Listeria in research environments

These developments underscore the importance of continued genomic surveillance of all Listeria species, including L. welshimeri, to track the emergence and spread of resistance mechanisms.

What advances in imaging techniques are enhancing MscL research?

Recent advances in imaging technologies are revolutionizing MscL research:

Fluorescence-Based Techniques:

  • GFP fusion proteins: Allow visualization of MscL in living bacteria using confocal microscopy, confirming membrane localization and functional channel formation .

  • Super-resolution microscopy: Techniques like PALM, STORM, and STED provide nanoscale resolution of MscL distribution and clustering.

  • Single-molecule tracking: Enables analysis of MscL dynamics in living cells.

Structural Imaging:

  • Cryo-electron microscopy: Providing near-atomic resolution of MscL in different conformational states.

  • Atomic force microscopy: For topographical imaging of MscL in membranes.

  • X-ray crystallography: For high-resolution static structures of MscL.

Functional Imaging:

  • Calcium imaging: In MscL-expressing cells to visualize channel activity.

  • Voltage-sensitive dyes: For optical recording of MscL-mediated membrane potential changes.

  • FRET-based tension sensors: To correlate local membrane tension with MscL activity.

Combined Approaches:

  • Correlative light and electron microscopy: Linking functional imaging with ultrastructural analysis.

  • Patch-clamp fluorometry: Simultaneous electrophysiological recording and fluorescence imaging.

These advanced imaging methods provide unprecedented insights into MscL structure, localization, dynamics, and function, facilitating more comprehensive understanding of mechanosensation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.