Recombinant Listeria welshimeri serovar 6b Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Listeria welshimeri

Listeria welshimeri is a species of bacteria within the Listeria genus, sharing characteristics with other Listeria species, such as being small, non-spore-forming, Gram-positive rods motile at temperatures below 30°C via peritrichous flagella . This bacterium can grow at low temperatures (4°C) within 5 days and does not produce a positive result in the CAMP test using Staphylococcus aureus and Rhodococcus equi . L. welshimeri tests negative for oxidase but positive for catalase activity, producing acid through the fermentation of D-xylose and α-methyl-D-mannoside, but not from L-rhamnose and D-mannitol . L. welshimeri was first isolated from decaying plants and is identified as serovar 6b .

Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA), also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), is an enzyme with the EC number 3.4.23.36 .

Recombinant LspA of Listeria welshimeri serovar 6b

Recombinant Listeria welshimeri serovar 6b Lipoprotein signal peptidase (LspA) is a form of the LspA enzyme produced using recombinant DNA technology . This involves cloning the gene encoding LspA from Listeria welshimeri serovar 6b into a suitable expression vector and expressing it in a host organism . The recombinant protein can then be purified for use in various applications, such as ELISA assays .

Applications of Recombinant LspA

ELISA assays using recombinant Listeria welshimeri serovar 6b Lipoprotein signal peptidase (LspA) are available for purchase .

Differentiating Listeria Species

A Listeria welshimeri DNA fragment homologous to the fibronectin-binding protein-encoding gene (fbp) of Listeria monocytogenes has been cloned and sequenced . L. welshimeri expresses a 24.8-kDa protein that binds to human fibronectin . PCR assays have been developed for the identification of L. welshimeri and L. monocytogenes based on the fbp sequences . The fbp gene displays a degree of allelic variation among isolates of L. monocytogenes, whereas the corresponding amplified fragment of L. welshimeri is monomorphic among all tested isolates of this species .

Absence of Virulence Genes

Neither L. innocua nor L. welshimeri isolates exhibit the major virulence genes typically found in the pathogenic L. monocytogenes . L. monocytogenes is estimated to cause about 1,600 illnesses each year in the United States with more than 1,500 related hospitalizations and 260 related deaths .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; lwe1863; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
lspA
Target Protein Sequence
MYYYLITLAVIALDQLTKWFVVQNMEIGQKIEVIPGFLYWTSYRNDGAAWSILEGHMWFF YLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVWGNY YFPIFNVADASLSVGVVLMLVYVFVDDRKTKGIK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: lwe:lwe1863

STRING: 386043.lwe1863

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Lipoprotein signal peptidase (lspA) in Listeria welshimeri?

Lipoprotein signal peptidase (lspA) in Listeria welshimeri serovar 6b is an enzyme also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), with the EC designation 3.4.23.36. The enzyme is encoded by the lspA gene (lwe1863 locus) and functions in the bacterial lipoprotein maturation pathway by cleaving signal peptides from prolipoproteins after lipid modification. In L. welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334), lspA consists of 154 amino acids with the sequence: MYYYLITLAVIALDQLTKWFVVQNMEIGQKIEVIPGFLYWTSYRNDGAAWSILEGHMWFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVWGNYYFPIFNVADASLSVGVVLMLVYVFVDDRKTKG . Structurally, lspA contains highly conserved residues and domains that are essential for its SPase II activity in lipoprotein processing .

  • What are the fundamental characteristics of Listeria welshimeri serovar 6b?

Listeria welshimeri serovar 6b is a non-pathogenic species of the genus Listeria that was first isolated from decaying plants. It is characterized as a small (0.5 to 2.0 μm), non-spore-forming, gram-positive rod that exhibits motility below 30°C through peritrichous flagella. The bacteria can grow at low temperatures (4°C) within 5 days, which is a characteristic of Listeria species. In biochemical assays, L. welshimeri tests negative in CAMP tests with Staphylococcus aureus and Rhodococcus equi, negative for oxidase, but positive for catalase activity . The species can be differentiated from other Listeria by its ability to produce acid from fermentation of d-xylose and α-methyl-d-mannoside but not from l-rhamnose and d-mannitol . Genomically, L. welshimeri lacks the pathogenicity islands found in pathogenic Listeria species such as L. monocytogenes .

  • How should recombinant lspA from Listeria welshimeri be stored and handled in laboratory settings?

Recombinant lspA from Listeria welshimeri requires specific storage conditions to maintain its stability and enzymatic activity. The protein should be stored in a Tris-based buffer containing 50% glycerol optimized for its stability . For long-term storage, the recommended temperature is -20°C or -80°C, while working aliquots can be kept at 4°C for up to one week . Researchers should avoid repeated freezing and thawing cycles as this can compromise protein integrity and function. When handling the protein for experimental work, standard protocols for recombinant proteins should be followed, including consideration of the protein's sensitivity to temperature fluctuations, pH changes, and proteolytic degradation. For experimental procedures, it is advisable to thaw aliquots on ice and use them immediately upon thawing to ensure optimal activity .

Advanced Research Questions

  • What methodologies can be employed to assess the activity of recombinant lspA in experimental settings?

Multiple experimental approaches can be used to evaluate recombinant lspA activity:

Globomycin Resistance Assay: Overexpression of functional lspA in E. coli confers increased resistance to globomycin, a specific inhibitor of SPase II. This property can be quantitatively measured to assess lspA functionality . The assay involves growing E. coli transformed with the recombinant lspA gene in media containing increasing concentrations of globomycin and determining the minimum inhibitory concentration.

Genetic Complementation: The ability of recombinant lspA to restore growth of temperature-sensitive E. coli strains (such as E. coli Y815) at non-permissive temperatures (42°C) provides evidence of its biological activity . The complementation can be quantified by measuring growth rates or colony formation efficiency.

Direct Enzymatic Assays: These involve using synthetic or natural prolipoprotein substrates and measuring the cleavage of signal peptides through techniques such as SDS-PAGE, Western blotting, or mass spectrometry.

In vitro Reconstitution: The lipoprotein processing pathway can be reconstituted using purified components to study lspA activity in a controlled environment, allowing examination of enzyme kinetics and substrate specificity .

  • How does the expression pattern of lspA compare to other genes involved in protein secretion?

  • What experimental evidence supports the functional conservation of lspA across bacterial species?

Cross-species functional studies provide compelling evidence for the conservation of lspA function:

Globomycin Resistance Transfer: The overexpression of lspA from different species in E. coli confers increased globomycin resistance, indicating functional conservation of the enzyme's core catalytic mechanism .

These experiments demonstrate that while the fundamental enzymatic function of lspA is conserved across diverse bacterial species, the efficiency and specific interactions with other components of the lipoprotein secretion pathway may be species-optimized.

  • How can bioinformatic approaches be used to predict lipoproteins processed by lspA in Listeria welshimeri?

Bioinformatic prediction of lipoproteins that may be processed by lspA in Listeria welshimeri involves several sophisticated computational approaches:

Signal Peptide Prediction: Tools such as SignalP (version 3.0 or newer) employ neural network and hidden Markov model algorithms to identify proteins with putative signal peptide sequences . When applied to the L. welshimeri genome, such analysis can identify secretory proteins from the total proteome.

Lipoprotein Prediction: Specialized tools like LipoP (version 1.0 or newer) can specifically identify putative lipoproteins based on characteristic sequence features, particularly the lipobox motif (typically [LVI][ASTVI][GAS][C]) where the cysteine residue becomes lipid-modified .

Comparative Genomics: By comparing predicted lipoproteins across Listeria species, researchers can identify conserved and species-specific substrates for lspA.

Proteome-wide Analysis: A comprehensive in silico analysis of the L. welshimeri genome (approximately 838 annotated ORFs) using these tools identified 89 secretory proteins with putative signal peptide sequences, of which 14 were recognized as putative lipoproteins . This ratio aligns with the observed higher expression levels of lepB (processing non-lipoproteins) compared to lspA and lgt (processing lipoproteins).

Experimental Applications

  • What is the role of lspA in bacterial physiology and how can it be experimentally determined?

Lipoprotein signal peptidase (lspA) plays a crucial role in bacterial physiology by ensuring proper processing and localization of lipoproteins. The physiological importance of lspA can be experimentally determined through several approaches:

Gene Knockout Studies: Creation of lspA deletion mutants can reveal the physiological consequences of impaired lipoprotein processing. In many bacteria, lspA is essential for viability, and its deletion can lead to accumulation of unprocessed prolipoproteins in the membrane, affecting membrane integrity and function.

Conditional Expression Systems: For essential genes like lspA, conditional expression systems can be employed to study the effects of reduced lspA levels on bacterial growth, morphology, and stress responses.

Transcriptional Analysis: Real-time quantitative PCR can monitor lspA expression under various environmental conditions, revealing regulatory patterns and potential co-regulation with other genes involved in membrane biogenesis or stress response .

Lipoprotein Profiling: Comparative proteomic analysis of wild-type and lspA-deficient strains can identify the complement of lipoproteins affected by lspA activity, providing insights into the cellular processes dependent on proper lipoprotein processing.

Stress Response Assays: Testing the susceptibility of lspA mutants to various stressors (antibiotics, osmotic stress, pH changes) can reveal the role of properly processed lipoproteins in stress tolerance mechanisms.

  • How can recombinant lspA be used in comparative studies between pathogenic and non-pathogenic Listeria species?

Recombinant lspA from Listeria welshimeri (non-pathogenic) provides a valuable tool for comparative studies with pathogenic Listeria species such as L. monocytogenes:

Biochemical Comparisons: Side-by-side analysis of enzymatic properties (substrate specificity, kinetic parameters, inhibitor sensitivity) between lspA from different Listeria species can reveal adaptations potentially linked to pathogenicity.

Cross-complementation Studies: Testing whether lspA from non-pathogenic L. welshimeri can functionally complement lspA mutations in pathogenic L. monocytogenes, and vice versa, can provide insights into functional conservation and specialization.

Structural Comparisons: Comparative structural analysis of lspA from pathogenic and non-pathogenic species might reveal species-specific features that could be targeted for antimicrobial development.

Substrate Profiling: Identifying differences in the lipoprotein substrates processed by lspA in pathogenic versus non-pathogenic species could highlight lipoproteins potentially involved in virulence.

Evolutionary Analysis: Comparative genomic analysis suggests that non-pathogenic Listeria species like L. welshimeri evolved from ancestral pathogenic strains through gene loss and acquisition of novel genes . Studying lspA in this context can provide insights into the evolution of pathogenicity within the Listeria genus.

This comparative approach can contribute to understanding the fundamental differences between pathogenic and non-pathogenic Listeria species and potentially identify novel targets for antimicrobial development.

  • What methods can be used to assess potential inhibitors of lspA for antimicrobial development?

Several experimental approaches can be employed to identify and characterize potential inhibitors of lspA for antimicrobial development:

Globomycin-based Assays: Globomycin is a known specific inhibitor of SPase II. Comparative studies using globomycin as a reference can help identify novel inhibitors. The assay measures bacterial growth inhibition in the presence of candidate compounds .

In vitro Enzymatic Assays: Purified recombinant lspA can be used in biochemical assays with synthetic substrates to directly measure inhibition of enzymatic activity by candidate compounds. These assays typically monitor the cleavage of fluorogenic or chromogenic substrates.

Structure-based Drug Design: If the three-dimensional structure of lspA is available or can be modeled, computational approaches such as molecular docking and virtual screening can identify potential inhibitors that bind to the active site or other critical regions of the enzyme.

Whole-cell Screening: Testing compounds for their ability to inhibit bacterial growth, with subsequent validation that the mechanism involves lspA inhibition rather than other targets.

Resistance Development Studies: Assessing the potential for resistance development by exposing bacteria to sub-inhibitory concentrations of candidate inhibitors and monitoring for mutations in lspA or related genes.

The data from these experiments would be compiled into a comprehensive inhibitor profile that includes:

ParameterMeasurement MethodSignificance
IC50 valuesDose-response enzymatic assaysPotency of inhibition
Selectivity ratioComparison with inhibition of other proteasesTarget specificity
MIC valuesGrowth inhibition assaysWhole-cell efficacy
CytotoxicityMammalian cell viability assaysSafety profile
Resistance frequencySelection of resistant mutantsResistance barrier

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.