Recombinant Listeria welshimeri serovar 6b Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; lwe2629; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
kdpC
Target Protein Sequence
MKRFMQIWKPAVVGFLLLTLVCGVVYPGIVTIIAGAAFQDKANGSIIERKLANGETGKYG SNEIGQTFTKPEYLIGRAASDGAATNLNPTSEEQKQLVEKRIAWWHKLDPTNNRVIPMDL VTASASGVDPDISEAAAAYQVDRISRERGISTKTVKEIIAEHTSNRLLGFWGEPTVNVLQ VNLALDSLKM
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. This subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: lwe:lwe2629

STRING: 386043.lwe2629

Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Listeria welshimeri serovar 6b Potassium-transporting ATPase C chain (kdpC)?

Recombinant Listeria welshimeri serovar 6b Potassium-transporting ATPase C chain (kdpC) is a 190-amino acid protein that functions as part of the high-affinity potassium uptake system in this non-pathogenic Listeria species. The recombinant form is typically expressed with an N-terminal His-tag in E. coli expression systems, enabling efficient purification and experimental manipulation . The kdpC protein serves as a critical component of the Kdp-ATPase complex, which bacteria utilize for potassium homeostasis under conditions of potassium limitation or osmotic stress. Unlike its counterparts in pathogenic Listeria species, the L. welshimeri kdpC exists in a genomic context lacking major virulence determinants, making it valuable for comparative studies of protein function separate from pathogenicity mechanisms .

How does the kdp system differ between Listeria welshimeri and pathogenic Listeria species?

The kdp locus in Listeria species encodes products homologous to structural proteins of a high-affinity potassium uptake system and a two-component signal transduction system commonly involved in controlling gene expression . While the fundamental structure of the Kdp system remains conserved, significant differences exist between L. welshimeri and pathogenic species like L. monocytogenes.

L. welshimeri lacks the major virulence determinants located on the chromosomal locus between prs and ldh (known as the virulence gene cluster "vgc" or Listeria pathogenicity island 1, "LIPI-1"), which are present in pathogenic Listeria species . This genomic distinction suggests that L. welshimeri evolved through the loss of the vgc region from a progenitor strain that originally contained these virulence genes. Consequently, while the kdp system maintains its role in potassium transport, its regulatory network and interaction with other cellular processes likely differ between pathogenic and non-pathogenic Listeria species, potentially affecting how the kdpC protein functions within the larger bacterial physiology.

What are the functional implications of studying kdpC in a non-pathogenic Listeria species?

Studying kdpC in L. welshimeri provides several research advantages due to its non-pathogenic nature. The absence of virulence determinants allows researchers to investigate the fundamental functions of the potassium transport system without confounding variables related to virulence mechanisms . This creates an opportunity to understand the evolutionary divergence of essential physiological systems between pathogenic and non-pathogenic bacteria that share a common ancestor.

The kdp system in Listeria has been shown to contribute to growth under osmotic pressure conditions. Research on L. monocytogenes has demonstrated that the kdpE gene (encoding the transcriptional response regulator) and the downstream gene orfX influence bacterial adaptation to NaCl and low temperature . By extension, investigating these mechanisms in L. welshimeri can elucidate whether these adaptations represent core bacterial functions or if they interact with pathogenicity traits in virulent species. This comparative approach provides insights into bacterial evolution and the relationship between basic physiological processes and virulence.

What expression systems are optimal for producing recombinant kdpC protein?

The optimal expression system for recombinant L. welshimeri kdpC protein utilizes E. coli with N-terminal His-tagging for several reasons . E. coli expression systems offer high yield, established protocols, and compatibility with membrane proteins. When expressing kdpC, researchers should consider the following methodological approach:

Expression System Optimization Table:

ParameterRecommended SettingJustification
Expression HostE. coli BL21(DE3)Reduced protease activity; T7 RNA polymerase compatibility
VectorpET series (e.g., pET28a)Strong T7 promoter; His-tag options
Induction0.5 mM IPTG, 18°C overnightLower temperature reduces inclusion body formation
MediaLB supplemented with 10 mM K+Maintains physiological relevance
Cell LysisSonication or French PressMembrane proteins require efficient disruption

When optimizing expression, monitoring protein solubility is crucial as membrane-associated proteins like kdpC can form inclusion bodies. Solubility can be enhanced by reducing induction temperature and adding glycerol (5-10%) to stabilize membrane protein fractions during purification.

What purification strategies yield the highest purity and activity of recombinant kdpC?

Purification of recombinant kdpC requires specialized approaches to maintain protein integrity and function. Based on established protocols for similar membrane-associated proteins, the following methodological workflow is recommended:

  • Initial Purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin effectively captures His-tagged kdpC .

  • Detergent Selection: Mild detergents like n-dodecyl-β-D-maltoside (DDM) at 0.05-0.1% maintain native protein conformation during membrane protein extraction.

  • Buffer Optimization: Inclusion of potassium (5-10 mM) in purification buffers helps stabilize conformation.

  • Secondary Purification: Size exclusion chromatography separates monomeric kdpC from aggregates and contaminants.

  • Quality Assessment: SDS-PAGE analysis combined with Western blotting confirms purity, while circular dichroism spectroscopy verifies proper folding.

For functional studies, researchers should verify activity immediately after purification, as membrane proteins typically exhibit reduced stability in solution compared to soluble proteins.

How can researchers assess the functional activity of recombinant kdpC?

Assessing the functional activity of recombinant kdpC requires methods that evaluate both its ability to assemble into the Kdp complex and its contribution to potassium transport. The following approaches provide comprehensive functional assessment:

Functional Assay Methodology:

  • Reconstitution Assays: Incorporate purified kdpC with other Kdp complex components (KdpA, KdpB) in liposomes to restore transport function.

  • ATPase Activity Measurement: While kdpC itself lacks ATPase activity, its presence enhances the ATPase activity of the complete complex, which can be measured through phosphate release assays.

  • Potassium Transport Assays: Monitor potassium flux in reconstituted proteoliposomes using fluorescent potassium indicators or radioactive 86Rb+ as a K+ analog.

  • Interaction Studies: Utilize surface plasmon resonance or co-immunoprecipitation to confirm binding interactions between kdpC and other Kdp components.

  • Complementation Experiments: Express recombinant kdpC in kdpC-deficient bacterial strains and measure growth restoration under potassium-limiting conditions. This approach has been validated in studies examining the role of kdp genes in bacterial adaptation to osmotic stress .

How does L. welshimeri kdpC structure differ from kdpC in other bacterial species?

The structural analysis of L. welshimeri kdpC reveals similarities and differences compared to homologs in other bacterial species. While high-resolution structures specific to L. welshimeri kdpC are not detailed in the provided information, comparative analysis can be performed based on sequence homology and predicted structural features:

Structural Comparison of kdpC Across Bacterial Species:

FeatureL. welshimeri kdpCE. coli kdpCOther Gram-positive bacteria
Length190 amino acids 190 amino acids185-195 amino acids
Membrane AssociationSingle transmembrane domainSingle transmembrane domainSingle transmembrane domain
Conservation of KdpB InterfaceHighReference standardVariable
N-terminal domainCytoplasmicCytoplasmicCytoplasmic

The functional significance of these structural differences likely relates to species-specific adaptations for potassium acquisition under varying environmental conditions. Researchers should consider these structural variations when designing experiments or interpreting results across different bacterial models.

What approaches should be used to study kdpC regulation in response to environmental stress?

Research on the Listeria kdp system has demonstrated its involvement in adaptation to environmental stresses including high salt concentration (NaCl) and low temperature . To study kdpC regulation comprehensively, researchers should implement multi-level analysis approaches:

Methodology for Studying kdpC Regulation:

  • Transcriptional Analysis: Quantitative RT-PCR to measure kdpC mRNA levels under various stress conditions, including potassium limitation, osmotic stress, and temperature shifts.

  • Promoter Analysis: Reporter gene assays (e.g., using lacZ or GFP fusions) to identify regulatory elements controlling kdpC expression.

  • Protein Interaction Studies: Chromatin immunoprecipitation (ChIP) to identify regulatory proteins binding to the kdp operon promoter.

  • Signal Transduction Mapping: Phosphorylation analysis of the KdpD/KdpE two-component system that regulates kdp expression in response to environmental signals.

  • Comparative Genomics: Analyze promoter regions across Listeria species to identify conserved regulatory elements versus species-specific adaptations.

In L. monocytogenes, transcriptional analysis has revealed that kdpE and orfX are encoded by the same transcript, suggesting coordinated regulation . Researchers studying L. welshimeri should determine if similar operon structures exist and how this affects kdpC expression in response to environmental conditions.

How can researchers differentiate between the roles of kdpC and other potassium transport systems?

Bacteria typically possess multiple potassium transport systems that function under different conditions. To specifically elucidate kdpC function, researchers should employ these experimental approaches:

  • Gene Deletion Studies: Create precise kdpC gene knockouts while leaving other potassium transport systems intact. This allows assessment of kdpC-specific phenotypes.

  • Complementation Assays: Restore kdpC expression in knockout strains to confirm phenotype reversal and validate gene function.

  • Expression Analysis: Monitor expression patterns of all potassium transport systems simultaneously to identify compensatory mechanisms.

  • Growth Studies Under Varying Conditions: Compare growth of wild-type and kdpC mutant strains under defined potassium concentrations, osmotic conditions, and pH values to identify conditions where kdpC function becomes essential.

  • Electrophysiological Measurements: Use patch-clamp techniques on bacterial spheroplasts or reconstituted systems to directly measure transport activity.

Studies in L. monocytogenes have demonstrated that deletion mutants lacking kdpE or orfX show measurable phenotypes when grown under specific stress conditions, including altered growth responses to NaCl . Similar methodological approaches can be applied to study L. welshimeri kdpC.

How can structural biology approaches advance our understanding of kdpC function?

Advanced structural biology techniques offer powerful insights into kdpC function and interactions within the Kdp complex:

Structural Biology Approaches for kdpC Research:

  • X-ray Crystallography: Determination of high-resolution crystal structures requires purification of kdpC to homogeneity, potentially in complex with other Kdp components. This provides atomic-level details of protein conformation and interaction interfaces.

  • Cryo-Electron Microscopy (Cryo-EM): Especially valuable for membrane protein complexes, cryo-EM can resolve the structure of the entire Kdp complex, elucidating how kdpC contributes to the functional assembly.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique identifies regions of kdpC that undergo conformational changes upon complex formation or in response to potassium concentrations.

  • Molecular Dynamics Simulations: Computational approaches can model kdpC behavior within a membrane environment and predict how sequence variations might affect function.

  • NMR Spectroscopy: For specific domains or smaller fragments of kdpC, NMR can provide dynamic information about protein motion and ligand interactions.

These structural approaches would complement functional studies and help resolve mechanistic questions about how kdpC contributes to potassium transport efficiency in L. welshimeri compared to other bacterial species.

What is the relationship between kdpC and bacterial stress response pathways?

The relationship between kdpC and bacterial stress response mechanisms extends beyond simple potassium transport. Research has identified connections to broader stress adaptation pathways:

In Listeria, the gene downstream of kdpE (orfX) bears similarity to RsbQ, which in Bacillus subtilis participates in the activation cascade of the general stress sigma factor SigB . This suggests potential crosstalk between potassium homeostasis and general stress responses. At low temperatures, a deletion mutant lacking orfX resumed growth slightly faster than wild-type, a phenotype shared by a mutant with an in-frame deletion of sigB .

Research Methodologies to Explore These Connections:

  • Transcriptomic Analysis: RNA-Seq comparing wild-type and kdpC mutant strains under various stress conditions to identify genes with altered expression.

  • Protein-Protein Interaction Studies: Pull-down assays or bacterial two-hybrid systems to identify stress-related proteins that interact with kdpC or other Kdp complex components.

  • Metabolomic Analysis: Measure changes in cellular metabolites in response to kdpC manipulation to identify metabolic pathways affected by altered potassium transport.

  • Phenotypic Microarrays: Test growth under hundreds of stress conditions simultaneously to identify specific stressors where kdpC function becomes critical.

Understanding these interconnections could reveal how bacteria integrate multiple environmental signals to coordinate adaptive responses, potentially identifying new targets for antimicrobial development.

How might kdpC be utilized in comparative evolutionary studies across Listeria species?

The non-pathogenic nature of L. welshimeri makes its kdpC protein particularly valuable for evolutionary studies:

The genome sequence of L. welshimeri reveals that this species lacks major virulence determinants present in pathogenic Listeria species, suggesting that the genus Listeria likely evolved through the loss of virulence genes from a progenitor strain already harboring these elements . This evolutionary context provides a framework for studying kdpC as a conserved physiological component that predates the specialization of different Listeria species into pathogenic and non-pathogenic lineages.

Methodological Approaches for Evolutionary Studies:

  • Phylogenetic Analysis: Construct detailed phylogenetic trees based on kdpC sequences across all Listeria species to track evolutionary divergence.

  • Functional Complementation: Exchange kdpC genes between species to identify functional conservation versus species-specific adaptations.

  • Selective Pressure Analysis: Calculate dN/dS ratios to identify regions of kdpC under different selective pressures in pathogenic versus non-pathogenic Listeria.

  • Ancestral Sequence Reconstruction: Computationally predict ancestral kdpC sequences to understand the evolutionary trajectory of this protein.

  • Horizontal Gene Transfer Analysis: Examine flanking regions of the kdp operon for evidence of genomic islands or mobile genetic elements that might indicate horizontal acquisition.

These approaches could provide insights into how essential physiological systems like potassium transport are maintained during bacterial evolution while other systems (like virulence factors) undergo substantial modification or loss.

What strategies can overcome common challenges in recombinant kdpC expression?

Researchers frequently encounter challenges when expressing membrane-associated proteins like kdpC. The following methodological approaches address common issues:

Troubleshooting Expression Issues:

ChallengeSolution StrategyMethodological Details
Poor SolubilityOptimize extraction conditionsTest multiple detergents (DDM, LDAO, CHAPS) at varying concentrations; include glycerol (5-10%) in extraction buffers
Low Expression YieldModify expression parametersTest different E. coli strains (BL21, C41, C43); reduce induction temperature to 16-18°C; use auto-induction media
Protein DegradationEnhance stabilizationAdd protease inhibitors; include potassium in all buffers; perform all steps at 4°C
Inclusion Body FormationRefold proteinSolubilize inclusion bodies in 8M urea, then slowly dilute into refolding buffer containing appropriate detergent
Tag InterferenceTest alternative tagging strategiesCompare N-terminal vs. C-terminal His-tags; consider smaller tags like Strep-tag II

Success in recombinant protein work often requires systematic optimization of multiple parameters simultaneously. Researchers should implement careful controls at each step to track improvements in protein quality and yield.

How should researchers interpret conflicting results in kdpC functional studies?

When faced with contradictory results in kdpC research, a methodical approach to reconciliation is essential:

  • Strain Verification: Confirm the genetic background of L. welshimeri strains used, as laboratory isolates may accumulate mutations affecting kdpC function.

  • Experimental Condition Analysis: Systematically compare experimental conditions across studies, particularly potassium concentrations, osmolarity, and growth media composition.

  • Protein Preparation Differences: Evaluate how recombinant protein was prepared, as variations in purification protocols can affect protein activity and stability .

  • Methodological Controls: Implement positive and negative controls for each functional assay to establish the dynamic range and sensitivity of the measurement approach.

  • Complementary Techniques: Apply multiple, independent methodologies to assess the same functional parameter, seeking convergent evidence.

When analyzing functional data for kdpC and related proteins, researchers should consider implementing self-controlled experimental designs rather than case-control designs when possible, as the former typically reveals less bias in retrospective studies .

What considerations are important when designing genetic manipulation experiments for kdpC studies?

Genetic manipulation of the kdp system requires careful experimental design to avoid unintended consequences:

Key Considerations for Genetic Manipulation:

  • Polar Effects: The operon structure of kdp genes means that manipulating kdpC may affect downstream gene expression. Research in L. monocytogenes has shown that kdpE and the downstream orfX are encoded on the same transcript . Design gene deletions that preserve reading frames and regulatory elements for unintended targets.

  • Complementation Controls: When complementing kdpC deletions, use both constitutive and native promoters to distinguish between direct and regulatory effects.

  • Marker Selection: Choose selection markers that don't affect potassium homeostasis or osmotic pressure sensing.

  • Temporal Control: Consider inducible systems for kdpC expression to study the kinetics of response to environmental changes.

  • Single-Copy Integration: For physiologically relevant studies, integrate complementing genes at single copy rather than using multi-copy plasmids that may cause overexpression artifacts.

These considerations ensure that phenotypes observed in genetic studies can be confidently attributed to specific kdpC functions rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.