Recombinant Listeria welshimeri serovar 6b Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant HtpX is a full-length, His-tagged protease homolog expressed in Escherichia coli ( ). Derived from Listeria welshimeri serovar 6b (strain ATCC 35897/DSM 20650/SLCC5334), it shares functional homology with stress-responsive proteases in other Listeria species, such as L. monocytogenes HtpX, which regulates protein quality control under metal ion stress .

Expression and Purification:

  • Cloned into E. coli vectors for high-yield expression.

  • Purified via affinity chromatography using His-tag .

Research Applications

  • Enzyme Activity Assays: Used to characterize pH/temperature-dependent proteolytic activity .

  • Structural Studies: Supports crystallography or NMR to resolve metal-binding sites .

  • Pathogenicity Research: Investigates roles in Listeria stress adaptation and virulence .

Comparative Insights

  • Homology with L. monocytogenes HtpX:

    • Shares 90.7% amino acid identity with L. monocytogenes Fbp protein, a fibronectin-binding virulence factor .

    • Both proteins retain conserved fibronectin-binding regions, suggesting functional overlap in host adhesion .

Species-Specific PCR Differentiation:

Primers targeting htpX or fbp genes enable species discrimination (e.g., L. welshimeri vs. L. monocytogenes) via restriction enzyme-PCR (RE-PCR) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
htpX; lwe0945; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
htpX
Target Protein Sequence
MLFEQIAANKRKTVFIVIGFFIFVLMVGAAIGIIVWNNYLNGLILAAVIGAFYILIMVMT SSSVVMAMNRAKRITSKEQAPVLWDTVESMAMVASIPMPKVYIMNDLSLNAFSAGISPEK GAVAVTQGLLDNLERYELEGVIAHEVSHIRNYDIRLSTISIALVAVIAILSDLAMRMIFW GSVTGSRNNRKNDNNSGGGAQLIIYIVALVFVVLAPIIATAIQFALSRNREYLADASAIE LTRNPDGLIQALQKVSGDTKKMKEVSASSESIYFSSPLKSKKDKPGIFDSHPPISSRIER LENM
Uniprot No.

Target Background

Database Links

KEGG: lwe:lwe0945

STRING: 386043.lwe0945

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Listeria welshimeri serovar 6b Protease HtpX homolog?

Recombinant Listeria welshimeri serovar 6b Protease HtpX homolog is a 304 amino acid protein with a molecular weight of approximately 24.8 kDa . The primary sequence includes several hydrophobic regions that likely function as transmembrane segments, similar to the HtpX protease found in Escherichia coli which contains four hydrophobic regions (H1-H4) . The protein contains the characteristic M48 peptidase domain, which is a defining feature of this protease family .

What functional roles does HtpX play in bacterial physiology?

HtpX proteases are integral membrane proteins that contribute significantly to the quality control of membrane proteins in bacterial cells. Studies on the E. coli HtpX, a homolog of the Listeria welshimeri HtpX, suggest that these proteases eliminate malfolded and/or misassembled membrane proteins that could potentially disturb the structure and function of biological membranes . This proteolytic quality control is crucial for maintaining normal cellular activities and membrane integrity.

What are the recommended methods for recombinant expression of Listeria welshimeri HtpX?

For successful recombinant expression of Listeria welshimeri HtpX, researchers should consider the following methodological approach:

  • Gene Amplification: Design primers containing appropriate restriction sites (such as BamHI and SmaI) based on the htpX gene sequence. Use genomic DNA from Listeria welshimeri as a template for PCR amplification .

  • Vector Selection: Choose an expression vector compatible with your experimental goals. For example, pHT43 has been successfully used for recombinant expression of similar proteases . Alternatively, the pGex-5X-3 vector has been used for cloning Listeria DNA fragments .

  • Host Selection: Transform the recombinant plasmid into an appropriate expression host. E. coli strains like DH5α or BL21(DE3) can be used for initial cloning and verification, while Bacillus subtilis WB800N has been utilized for expression of similar proteases to improve transformation efficiency .

  • Expression Conditions: Culture the engineered strain to an OD600 of approximately 0.6-0.8 before inducing protein expression with IPTG at a final concentration of 1 mM. Optimize temperature, induction time, and media composition based on preliminary expression trials .

  • Protein Verification: Analyze the expression by SDS-PAGE, and confirm the identity and activity of the recombinant protein through appropriate enzymatic assays .

This systematic approach ensures reliable production of functionally active recombinant Listeria welshimeri HtpX for subsequent characterization and application studies.

How can researchers develop reliable activity assays for studying HtpX protease function?

Developing reliable activity assays for HtpX protease function requires careful consideration of the enzyme's characteristics. Based on the research with E. coli HtpX, an in vivo semiquantitative and convenient protease activity assay system can be established using model substrates . The following methodological approach is recommended:

  • Model Substrate Construction: Design and construct a model substrate specifically for HtpX. For example, researchers studying E. coli HtpX developed a model substrate called XMS1 (HtpX Model Substrate 1) that allows sensitive detection of protease activity .

  • Detection System Design: Incorporate reporter elements into your model substrate that facilitate detection of proteolytic activity. This could include fusion to fluorescent proteins like GFP or tags that can be detected by immunoblotting .

  • In vivo Assay Implementation: Express both the HtpX protease and the model substrate in the same cell to allow for in vivo proteolytic processing. This approach mimics the natural cellular environment of the protease .

  • Quantification Methods: Develop methods to quantify the degree of substrate cleavage, such as measuring the ratio of cleaved to uncleaved substrate using Western blotting or fluorescence-based techniques .

  • Validation with Mutants: Validate the assay system by testing HtpX mutants carrying mutations in conserved regions to detect differential protease activities .

This methodology provides a systematic approach to studying HtpX protease function and can be adapted for investigating HtpX homologs in other bacteria, including Listeria welshimeri.

How can researchers investigate the metal ion dependency of HtpX protease activity?

Investigating the metal ion dependency of HtpX protease activity requires a systematic approach combining structural analysis and functional assays. The following methodology is recommended:

  • Tertiary Structure Prediction: Utilize computational tools such as AlphaFold3 to predict the tertiary structure of the HtpX protease, providing insights into potential metal binding sites .

  • Binding Pocket Analysis: Employ CASTpFold or similar tools to analyze the D3 pocket and its potential interactions with metal ions. Focus on prominent concave protein regions frequently associated with binding events, utilizing alpha shape and pocket algorithms from computational geometry .

  • Metal Chelation Experiments: Conduct enzyme activity assays in the presence of metal chelators (such as EDTA) to determine if activity is diminished, confirming metal ion dependency.

  • Metal Ion Supplementation: Systematically test the effect of various metal ions (Zn²⁺, Ca²⁺, Mg²⁺, etc.) on enzyme activity by adding these ions at different concentrations to the reaction mixture. Research has shown that binding of Ca²⁺ to recombinant HtpX protease can result in the formation of the largest active pocket .

  • Site-Directed Mutagenesis: Modify predicted metal-binding residues through site-directed mutagenesis and assess the impact on protease activity, which can confirm the importance of specific residues in metal coordination.

  • Structural Visualization: Use PyMOL or similar software to visualize the tertiary structure of the HtpX protease and illustrate the metal binding sites and their coordination geometry .

This comprehensive approach will provide detailed insights into the metal ion requirements for HtpX protease activity, which is crucial for understanding its catalytic mechanism and potential applications.

What are the challenges in identifying physiological substrates of Listeria welshimeri HtpX?

Identifying the physiological substrates of Listeria welshimeri HtpX presents several methodological challenges that researchers must address:

  • Membrane Protein Complexity: Since HtpX is a membrane-embedded protease that likely targets membrane proteins, researchers face difficulties in isolating and analyzing integral membrane proteins due to their hydrophobic nature and tendency to aggregate when removed from membrane environments .

  • Substrate Transience: The physiological substrates may be rapidly degraded after cleavage by HtpX, making their detection challenging in standard proteomic approaches.

  • Functional Redundancy: Other proteases may have overlapping specificity with HtpX, complicating the identification of HtpX-specific substrates through gene knockout studies alone.

  • Model System Development: Unlike E. coli HtpX, which has established model substrates, specific model substrates for Listeria welshimeri HtpX have not been well-characterized, necessitating the development of new model systems .

  • Methodological Approaches: Researchers can address these challenges through:

    • Developing proteomic approaches combining membrane protein enrichment with quantitative proteomics

    • Creating conditionally active HtpX variants to capture substrate interactions

    • Using comparative studies between wild-type and htpX-deficient strains under stress conditions that might trigger increased quality control requirements

    • Implementing in vivo crosslinking strategies to capture transient enzyme-substrate interactions

These methodological considerations highlight the complexity of identifying physiological substrates of membrane proteases like HtpX and suggest approaches for overcoming these research challenges.

How does Listeria welshimeri HtpX compare structurally and functionally to HtpX homologs in other bacterial species?

The structural and functional comparison of Listeria welshimeri HtpX with homologs in other bacterial species reveals both conservation and divergence in this protease family:

Understanding these similarities and differences provides valuable insights into the evolution of this protease family and can guide research on species-specific functions and applications.

What is known about HtpX expression in recombinant Listeria vaccine vectors?

Recombinant Listeria has emerged as a promising vaccine vector platform, with implications for HtpX expression and function in this context:

  • Attenuated Listeria Vectors: Recombinant Listeria monocytogenes strains carrying ΔactA and prfA* mutations have been developed as vaccine vectors. These strains secrete significantly more immunogen than wild-type strains and elicit robust immune responses . While these studies don't specifically focus on HtpX, they establish the framework for understanding protein expression in recombinant Listeria vectors.

  • Immune Response Characteristics: Intranasal vaccination with recombinant Listeria vectors elicits robust gamma interferon-positive (IFN-γ⁺) cellular responses in systemic sites, as well as appreciable pulmonary cellular responses and secretory mucosal IgA titers . These immune characteristics are important to consider when designing HtpX-based vaccine components.

  • Route of Administration Impact: The immune response to recombinant Listeria vectors varies significantly based on the route of administration (intranasal, intravenous, intraperitoneal, or subcutaneous), with each route generating a distinct profile of systemic and mucosal immune responses . This would likely impact the immunogenicity of any HtpX-expressing vectors.

  • Expression Optimization: For optimal expression of HtpX in Listeria vaccine vectors, similar approaches to those used for other recombinant proteins in Listeria could be applied, including codon optimization, use of strong promoters, and selection of appropriate secretion signals.

  • Safety Considerations: Since HtpX is involved in protein quality control, its overexpression in vaccine vectors would need to be carefully evaluated to ensure it doesn't compromise the stability or safety profile of the attenuated vector.

These insights provide a foundation for developing HtpX-expressing Listeria vaccine vectors, though specific studies on HtpX expression in this context remain an area for future research.

How might researchers apply HtpX in biotechnology and therapeutic development?

The unique properties of HtpX protease from Listeria welshimeri offer several promising applications in biotechnology and therapeutic development:

  • Enzyme-Based Biocatalysts: The heat-resistant properties of HtpX metalloprotease make it a potential candidate for industrial biocatalysis applications that require thermostable enzymes . Researchers could engineer the enzyme for improved stability and specificity for particular biotechnological processes.

  • Protein Engineering Tools: The specific proteolytic activity of HtpX could be harnessed for targeted protein processing in recombinant protein production workflows, potentially allowing for controlled cleavage of fusion proteins or removal of purification tags.

  • Vaccine Development: Building on the success of recombinant Listeria as vaccine vectors, HtpX could be explored as an antigen or as part of engineered vaccine strains. The intranasal vaccination approach with recombinant Listeria has shown promise in eliciting robust systemic and pulmonary cellular responses .

  • Antimicrobial Target: As a protease involved in quality control of membrane proteins, HtpX represents a potential target for novel antimicrobial compounds. Inhibitors of HtpX might disrupt bacterial membrane protein homeostasis, particularly under stress conditions.

  • Diagnostic Applications: The specific detection of HtpX or its activity could potentially be developed into diagnostic tools for identifying Listeria welshimeri or related species in clinical or food safety contexts .

  • Structure-Based Drug Design: With advanced structural analysis techniques, researchers could use the HtpX structure to design specific inhibitors or modulators with potential therapeutic applications .

These diverse applications highlight the biotechnological potential of HtpX protease and provide directions for future research and development efforts.

What are the promising future research directions for understanding HtpX function?

Several promising research directions would advance our understanding of HtpX function in Listeria welshimeri and related bacteria:

  • Comprehensive Substrate Identification: Developing advanced proteomic approaches to identify the physiological substrates of HtpX would significantly enhance our understanding of its biological role. This could involve techniques such as proximity labeling, quantitative proteomics comparing wild-type and htpX knockout strains, or substrate trapping approaches .

  • Regulatory Network Mapping: Investigating how htpX expression is regulated in response to various environmental stresses and growth conditions would provide insights into its role in bacterial adaptation. This could involve transcriptomic analyses under different stress conditions.

  • Structure-Function Relationship: Detailed structural studies of HtpX, including crystal structure determination, would enhance our understanding of its catalytic mechanism and substrate specificity. The binding of Ca²⁺ to the recombinant protease resulting in the formation of the largest active pocket represents an interesting starting point for such investigations .

  • In vivo Dynamics: Developing methods to study the dynamics of HtpX-mediated proteolysis in living cells, potentially using fluorescent reporters or time-resolved proteomics, would provide insights into the kinetics and context of its activity.

  • Evolutionary Analysis: Comparative genomic and phylogenetic analyses of htpX genes across diverse bacterial species could reveal evolutionary patterns and functional diversification of this protease family.

  • Model System Development: Creating improved model systems for studying HtpX function, similar to the in vivo protease activity assay developed for E. coli HtpX , would facilitate more detailed functional characterization.

These research directions would collectively advance our understanding of HtpX function and potentially reveal new applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.