Recombinant Listeria welshimeri serovar 6b Putative AgrB-like protein (lwe0039)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Context

Genomic Localization
The lwe0039 gene is encoded in the genome of L. welshimeri serovar 6b, a species distinct from the pathogenic L. monocytogenes. While genomic studies of L. welshimeri (e.g., strain SLCC5334) have identified virulence-related features, lwe0039 is not explicitly linked to pathogenicity in available literature .

Putative Function
AgrB-like proteins are typically involved in quorum sensing and virulence regulation in bacteria. Despite its homology to AgrB, lwe0039’s specific role remains undefined. Hypothetically, it may participate in:

  • Autoinducer peptide processing: Analogous to AgrB in Staphylococcus aureus, which processes autoinducing peptides (AIPs) to regulate biofilm formation and toxin production.

  • Stress adaptation: Potential involvement in stress resistance pathways, though direct evidence is lacking .

Research Applications and Challenges

Potential Uses

  1. Quorum-Sensing Studies: Investigating cross-species signaling mechanisms in Listeria.

  2. Antibiotic Resistance: Exploring interactions with heavy metal resistance systems (e.g., cadmium/arsenic resistance islands) .

  3. Diagnostic Tools: Developing assays to distinguish L. welshimeri from pathogenic Listeria spp. .

Limitations

  • Functional Data Gaps: No experimental validation of lwe0039’s role in quorum sensing or virulence.

  • Host Specificity: Expressed in E. coli, which may alter post-translational modifications compared to native L. welshimeri.

Comparative Insights from Related Proteins

Featurelwe0039 (L. welshimeri)AgrB (Staphylococcus aureus)
FunctionHypothetical QS regulationAutoinducer peptide processing
Expression HostE. coliNative host
TagHis-tagUntagged
Pathogenicity LinkNoneVirulence regulation

Sources: ,

Future Research Directions

  1. Functional Characterization:

    • Biochemical assays: Test peptide processing or signaling activity.

    • Knockout studies: Assess phenotypic changes in L. welshimeri.

  2. Evolutionary Analysis:

    • Compare lwe0039 homologs across Listeria species to infer ancestral functions.

  3. Industrial Applications:

    • Explore biotechnological uses in recombinant protein production.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lwe0039; Putative AgrB-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Target Names
lwe0039
Target Protein Sequence
MSNFTVKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINVMKFAIVYGISLATGL LLQTVTVHMSYLWLRRYSFGLHATKTLNCTLISLAMFVLAPFVFQNIPSNNWIVLGTFAF ILLNMFLFAPADTESLPLIGEKHRKTLKRKAMIGTLILTGIALLIPFAEMKTLIMVGSLF QVISINPLSYKLLKRRYRNYEKYE
Uniprot No.

Target Background

Function
This protein may be involved in the proteolytic processing of a quorum sensing system signal molecule precursor.
Database Links

KEGG: lwe:lwe0039

STRING: 386043.lwe0039

Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Listeria welshimeri and how does it relate to other Listeria species?

Listeria welshimeri is a non-pathogenic species within the genus Listeria. It shares significant genetic similarities with pathogenic species like Listeria monocytogenes, making it valuable for comparative genomic studies. The genomic content of L. welshimeri is characterized by a G+C content of approximately 36%, which is consistent with its chromosomal DNA . Unlike L. monocytogenes, L. welshimeri is not typically associated with human infections, allowing researchers to study Listeria molecular biology without the biosafety concerns associated with pathogenic strains.

How is recombinant Listeria welshimeri AgrB-like protein typically produced?

The recombinant production of Listeria welshimeri serovar 6b Putative AgrB-like protein (lwe0039) typically involves heterologous expression in Escherichia coli expression systems . The general methodology includes:

  • Cloning the lwe0039 gene into an appropriate expression vector with a histidine tag (His-tag)

  • Transforming the construct into a competent E. coli strain optimized for protein expression

  • Inducing protein expression under controlled conditions (temperature, media, inducer concentration)

  • Cell lysis to release the expressed protein

  • Purification using affinity chromatography (typically Ni-NTA for His-tagged proteins)

  • Quality control assessment through SDS-PAGE to confirm purity (>90% is standard)

  • Lyophilization or buffer exchange for stable storage

The resulting purified protein is generally stored as a lyophilized powder or in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with recommendations for adding 5-50% glycerol for long-term storage at -20°C/-80°C to prevent degradation .

How can Listeria welshimeri be specifically identified using molecular techniques?

Listeria welshimeri can be specifically identified using PCR-based assays that target the fibronectin-binding protein-encoding gene (fbp). A highly specific method involves using primer pairs G398 (5"-TGAAAGAGTTTATCGAGCCATACC-3") and G399 (5"-TTTATGGCCTTCTAGCACGTTCG-3"), which amplify a 170-bp DNA fragment from L. welshimeri chromosomal DNA but not from other Listeria species . The PCR conditions typically include:

  • Template DNA: 100-200 ng of purified chromosomal DNA

  • Primer concentration: 1 μM each

  • Taq DNA polymerase: 0.025 U/μl

  • Appropriate thermal cycling conditions

This assay has been validated against multiple isolates (15 strains) of L. welshimeri from different sources, including food samples and reference collections, confirming its reliability for specific identification without false positives from related Listeria species .

What is the relationship between the fbp gene in Listeria welshimeri and Listeria monocytogenes?

The fibronectin-binding protein-encoding gene (fbp) in Listeria welshimeri shares 88.4% nucleotide identity with the homologous gene in Listeria monocytogenes . This high degree of sequence conservation reflects the evolutionary relationship between these species while still allowing for species-specific molecular identification. Key differences include:

  • Specific restriction enzyme site variations (including MseI, RsaI, SacI, HhaI, DdeI, and TaqI sites)

  • Sufficient sequence divergence to design species-specific primers for differential amplification

  • Conservation of functional domains related to fibronectin binding

Despite the sequence similarities, the fbp gene demonstrates allelic variation even within L. monocytogenes strains. For example, the RsaI restriction site at positions 154-157 is not consistently present across all L. monocytogenes isolates . This variation must be considered when designing molecular identification assays.

What post-translational modifications are important for AgrB-like protein function?

While specific post-translational modifications (PTMs) of the L. welshimeri AgrB-like protein are not explicitly detailed in the provided search results, research on homologous AgrB proteins suggests several potential PTMs that may be critical for function:

  • Membrane insertion and topology: As a putative membrane protein, proper localization is essential for function. This likely involves signal sequence recognition and membrane integration machinery.

  • Disulfide bond formation: The conserved cysteine residues may form disulfide bridges critical for maintaining proper protein conformation.

  • Proteolytic processing: Some AgrB proteins undergo self-processing or are processed by other proteases to achieve functional maturity.

Researchers studying the L. welshimeri AgrB-like protein should consider these potential modifications when designing expression systems and functional assays, potentially using techniques like mass spectrometry to identify and characterize any PTMs present in the native protein.

What experimental approaches can be used to study the binding properties of recombinant Listeria welshimeri proteins?

To investigate the binding properties of recombinant L. welshimeri proteins, including the AgrB-like protein (lwe0039), researchers can employ several complementary approaches:

  • Solid-phase binding assays: Similar to methods used to study the fibronectin-binding properties of related Listeria proteins, researchers can immobilize potential binding partners on microplates and detect binding using antibodies against the recombinant protein or its tag .

  • Surface Plasmon Resonance (SPR): This label-free technique allows real-time monitoring of protein-protein interactions and determination of binding kinetics (kon and koff rates) and affinity constants (KD).

  • Pull-down assays: Using the His-tag of the recombinant protein, researchers can perform pull-down experiments to identify potential binding partners in complex biological samples.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking followed by proteolytic digestion and mass spectrometric analysis can identify proteins that interact with the AgrB-like protein in its native environment.

These methods should be optimized based on the specific properties of the AgrB-like protein, including its hydrophobicity and membrane association characteristics.

How can protein stability and storage conditions be optimized for functional studies?

Optimizing stability and storage conditions for the recombinant Listeria welshimeri AgrB-like protein is critical for maintaining its functional integrity. Based on established protocols, the following approaches are recommended:

  • Buffer optimization:

    • Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent

    • Conduct buffer screening experiments to identify optimal pH, salt concentration, and additives that enhance stability

  • Storage recommendations:

    • Store as lyophilized powder for maximum stability

    • For reconstituted protein, add 5-50% glycerol (final concentration) and store in small aliquots

    • Maintain at -20°C/-80°C for long-term storage

    • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and aggregation

  • Stability assessment methods:

    • Monitor protein stability over time using techniques such as dynamic light scattering (DLS) to detect aggregation

    • Use circular dichroism (CD) spectroscopy to assess secondary structure retention

    • Develop functional assays to verify that biological activity is maintained

For working solutions, maintain aliquots at 4°C for up to one week rather than repeatedly freezing and thawing the stock solution .

What techniques can be used to study the membrane topology of AgrB-like proteins?

Understanding the membrane topology of the AgrB-like protein is essential for functional characterization. Researchers can employ several methodologies:

  • Computational prediction:

    • Use algorithms like TMHMM, TopPred, or Phobius to predict transmembrane segments

    • Apply the positive-inside rule to estimate orientation of loops and termini

  • Experimental approaches:

    • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess their accessibility to membrane-impermeable labeling reagents

    • Protease protection assays: Determine which regions are protected from proteolytic digestion when the protein is embedded in membranes

    • Reporter fusion constructs: Create fusions with reporter domains (e.g., GFP, alkaline phosphatase) at different positions to determine their localization

  • Structural techniques:

    • Cryo-electron microscopy: For high-resolution structural analysis of membrane proteins

    • Site-directed spin labeling combined with EPR spectroscopy: To obtain distance constraints and dynamic information

These approaches can be combined to develop a comprehensive model of how the AgrB-like protein is oriented in the membrane, which is crucial for understanding its functional mechanisms.

How can protein engineering approaches be applied to modify the function of Listeria welshimeri AgrB-like protein?

Protein engineering of the Listeria welshimeri AgrB-like protein can be approached using methods similar to those described for other proteins, such as the PREVENT (PRotein Engineering by Variational frEe eNergy approximaTion) model . The following strategy could be implemented:

  • Computational design and thermodynamic modeling:

    • Apply variational free energy approximation to predict the thermodynamic stability of variants

    • Use evolutionary information and sequence conservation analysis to identify mutable positions

    • Model the effects of mutations on protein folding and function

  • Directed evolution approaches:

    • Create libraries of variants using methods like error-prone PCR, DNA shuffling, or site-saturation mutagenesis

    • Develop selection or screening systems to identify variants with desired properties

  • Structure-guided rational design:

    • If structural information is available or can be predicted, target specific residues involved in protein function

    • Introduce mutations that enhance stability or modify binding specificities

  • Functional validation:

    • Develop assays to test if engineered variants maintain proper membrane localization

    • Assess how modifications affect interaction with partner proteins or signaling pathways

This integrative approach combines computational predictions with experimental validation to efficiently explore the protein design space while maximizing the likelihood of generating functional variants .

What are the challenges in studying protein-protein interactions involving membrane proteins like AgrB?

Investigating protein-protein interactions (PPIs) involving membrane proteins such as the AgrB-like protein presents several unique challenges:

  • Solubilization and native conformation:

    • Maintaining the native conformation of membrane proteins when removed from the lipid bilayer

    • Selection of appropriate detergents or membrane mimetics that preserve protein structure and function

    • Risk of disrupting important interactions during solubilization

  • Technical limitations:

    • Reduced efficiency of traditional PPI methods (e.g., yeast two-hybrid) for membrane proteins

    • Background issues in co-immunoprecipitation due to detergent solubilization

    • Limited throughput of biophysical methods for membrane protein complexes

  • Reconstitution systems:

    • Need for appropriate lipid compositions that support native protein function

    • Challenges in controlling protein orientation during reconstitution

    • Variability in results depending on the membrane mimetic system used

  • Methodological adaptations:

    • Membrane-specific yeast two-hybrid systems (split-ubiquitin approach)

    • BRET/FRET assays optimized for membrane protein interactions

    • Proximity labeling approaches (BioID, APEX) that can capture transient interactions in cellular contexts

Researchers must consider these challenges when designing experiments to investigate interactions between the AgrB-like protein and potential binding partners, often employing multiple complementary approaches to build confidence in results.

How can comparative genomics and structural biology approaches inform functional studies of Listeria welshimeri proteins?

Integrating comparative genomics and structural biology provides powerful insights into the function of Listeria welshimeri proteins, including the AgrB-like protein (lwe0039):

  • Comparative genomic analyses:

    • Alignment of the lwe0039 gene with homologs in Listeria and other genera to identify conserved domains

    • Examination of genomic context to identify functionally related genes in operons or regulatory networks

    • Analysis of selection pressures on different protein domains to infer functional importance

  • Structural prediction and analysis:

    • Application of homology modeling based on structurally characterized AgrB proteins

    • Identification of conserved structural motifs involved in substrate recognition or catalysis

    • Prediction of protein-protein and protein-membrane interaction interfaces

  • Integration with experimental approaches:

    • Design of targeted mutations based on structural predictions to test functional hypotheses

    • Development of assays to test predicted substrate specificities or interaction partners

    • Validation of structural predictions through techniques like hydrogen-deuterium exchange mass spectrometry

  • Evolutionary context:

    • Understanding how structural and functional differences between L. welshimeri and pathogenic Listeria species reflect their ecological niches

    • Identifying potential adaptations specific to L. welshimeri that distinguish it from pathogenic relatives

This multidisciplinary approach leverages both computational and experimental methods to develop a comprehensive understanding of protein function within its biological context.

How can Listeria welshimeri research contribute to food safety applications?

Research on Listeria welshimeri, including studies of the AgrB-like protein (lwe0039), has significant implications for food safety applications:

These applications demonstrate how basic research on L. welshimeri contributes directly to applied food safety strategies and improved detection methods for monitoring food production systems.

What are the potential applications of recombinant Listeria proteins in vaccine development research?

While the search results do not directly address vaccine applications, we can extrapolate potential uses of recombinant Listeria welshimeri proteins in vaccine research:

  • Antigen carriers in recombinant vaccines:

    • Non-pathogenic Listeria proteins could serve as carriers for heterologous antigens

    • The natural adjuvant properties of some bacterial proteins may enhance immune responses

  • Development of subunit vaccines:

    • Recombinant proteins shared between pathogenic and non-pathogenic Listeria species could potentially be used in subunit vaccines

    • Studies of fibronectin-binding proteins and other conserved proteins could identify candidates that induce protective immunity

  • Safer alternatives to attenuated live vaccines:

    • L. welshimeri proteins could potentially replace L. monocytogenes counterparts in vaccine designs, reducing safety concerns

    • Engineering chimeric proteins combining immunogenic epitopes from pathogenic species with scaffolds from non-pathogenic L. welshimeri

  • Research tools for understanding immunity:

    • Purified recombinant proteins facilitate studies of antigen processing and presentation

    • Allowing detailed investigation of immune responses without the risks associated with pathogenic organisms

Research in this direction would require careful immunological characterization of the recombinant proteins and evaluation of their ability to induce protective immune responses relevant to Listeria infections.

How can advanced protein engineering techniques improve the stability and functionality of recombinant Listeria welshimeri proteins?

Advanced protein engineering techniques, such as those exemplified by the PREVENT model, offer promising approaches to enhance recombinant L. welshimeri proteins :

  • Thermodynamic optimization:

    • Application of variational free energy approximation to predict more stable protein variants

    • Screening for mutations that minimize the free energy of the folded state while maintaining function

    • Development of variants with improved storage stability and resistance to denaturation

  • Expression enhancement:

    • Engineering protein sequences to improve expression levels in heterologous systems

    • Codon optimization for the expression host

    • Introduction of stabilizing mutations that improve folding efficiency and reduce aggregation

  • Functionality modifications:

    • Targeted mutations to enhance specific functions (e.g., binding affinity, catalytic activity)

    • Domain swapping or fusion with other functional domains to create chimeric proteins with novel properties

    • Modification of surface properties to improve solubility while maintaining core functions

  • Experimental validation strategies:

    • High-throughput screening methods to evaluate multiple variants

    • Comprehensive characterization of thermodynamic and kinetic properties

    • Assessment of function in relevant biological contexts

According to data from similar protein engineering efforts, such approaches can yield significant improvements in protein stability and function, with success rates of up to 85% for maintaining or enhancing protein function despite introducing multiple mutations .

What are the optimal expression and purification conditions for recombinant Listeria welshimeri AgrB-like protein?

Based on established protocols for the recombinant production of Listeria welshimeri AgrB-like protein (lwe0039), the following optimized conditions are recommended:

  • Expression system selection:

    • E. coli is the preferred expression host for this protein

    • BL21(DE3) or similar strains designed for high-level protein expression are recommended

    • Consider using strains with extra copies of rare tRNAs if the protein contains rare codons

  • Expression vector and conditions:

    • Use vectors with strong, inducible promoters (T7, tac)

    • Include an N-terminal His-tag for purification

    • Optimize induction conditions (temperature, IPTG concentration, induction time) through small-scale expression tests

    • Lower expression temperatures (16-20°C) may improve folding of membrane-associated proteins

  • Cell lysis and protein extraction:

    • For membrane-associated proteins like AgrB, include appropriate detergents in lysis buffers

    • Consider mechanical disruption methods (sonication, homogenization) combined with enzymatic treatment

    • Optimize detergent type and concentration to solubilize the protein without denaturation

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins

    • Consider a secondary purification step (size exclusion, ion exchange) to achieve >90% purity

    • Carefully select buffer compositions that maintain protein stability

  • Quality control:

    • SDS-PAGE analysis to confirm purity and expected molecular weight

    • Western blotting to verify protein identity

    • Mass spectrometry for accurate molecular weight determination and sequence confirmation

These conditions should be optimized for each specific preparation to maximize yield and maintain functional integrity of the protein.

What controls should be included in experiments using recombinant Listeria welshimeri proteins?

Robust experimental design for studies involving recombinant Listeria welshimeri proteins should include the following controls:

  • Protein quality controls:

    • Purity assessment through SDS-PAGE and Coomassie staining

    • Western blot using anti-His antibodies to confirm tag presence and integrity

    • Activity/functionality assay specific to the protein being studied

    • Negative control using the same purification procedure with non-transformed E. coli

  • Experimental controls for binding studies:

    • Competitive inhibition controls using known ligands or antibodies

    • Heat-denatured protein control to distinguish specific from non-specific interactions

    • Tag-only control (e.g., His-peptide) to rule out tag-mediated interactions

    • Heterologous protein control with similar properties but different function

  • Specificity controls for identification assays:

    • When using PCR-based identification methods, include:

      • Positive controls using verified L. welshimeri strains

      • Negative controls using closely related Listeria species

      • Multiple isolates to account for strain variability

      • No-template controls to rule out contamination

  • Expression system controls:

    • Empty vector control for expression studies

    • Host cell background control for functional assays

    • Induction controls (induced vs. non-induced) to confirm regulated expression

These controls ensure the reliability and reproducibility of results and help distinguish specific biological effects from artifacts.

How can researchers troubleshoot common issues in working with recombinant membrane-associated proteins?

Working with membrane-associated proteins like the AgrB-like protein presents unique challenges. Here are systematic approaches to troubleshooting common issues:

  • Low expression yield:

    IssuePotential Solutions
    Toxicity to host cellsUse tightly regulated expression systems; lower induction levels
    Protein aggregationReduce expression temperature; co-express with chaperones
    Codon biasUse codon-optimized gene or host strains with rare tRNAs
    Proteolytic degradationAdd protease inhibitors; use protease-deficient host strains
  • Protein insolubility:

    ApproachMethodology
    Detergent screeningTest multiple detergent types and concentrations (e.g., DDM, LDAO, Triton X-100)
    Solubilization additivesInclude glycerol, arginine, or specific lipids in buffers
    Fusion tagsConsider solubility-enhancing tags (MBP, SUMO, Trx)
    Refolding protocolsDevelop controlled denaturation and refolding protocols if necessary
  • Loss of activity during purification:

    ProblemSolution Strategy
    Detergent effectsTry milder detergents or detergent mixtures
    Buffer optimizationScreen pH, ionic strength, and stabilizing additives
    Lipid requirementsAdd specific lipids or use lipid nanodiscs for reconstitution
    Metal ion dependenciesInclude relevant metal ions in buffers if the protein has metal-binding sites
  • Protein aggregation during storage:

    Storage IssueRecommended Approach
    Freeze-thaw damageAliquot before freezing; add cryoprotectants (glycerol, trehalose)
    Concentration-dependent aggregationDetermine optimal protein concentration range
    Buffer instabilityTest different buffer systems; adjust pH and ionic strength
    Long-term storageCompare lyophilization vs. frozen storage in different buffer compositions

Systematic documentation of conditions tested and outcomes observed is essential for efficient troubleshooting and optimization of protocols for membrane protein work.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.