Recombinant Listeria welshimeri serovar 6b UPF0266 membrane protein lwe0739 (lwe0739)

What is Listeria welshimeri and how does it differ from other Listeria species?

Listeria welshimeri is one of six species in the genus Listeria, which also includes L. monocytogenes, L. ivanovii, L. innocua, L. seeligeri, and L. grayi. L. welshimeri is generally classified as non-pathogenic, unlike L. monocytogenes and L. ivanovii, which are known pathogenic species. L. welshimeri is a motile, gram-positive, facultative anaerobic rod-like bacterium that can be found in decaying plants, soil, sewage, dust, and water . It has the smallest genome in the genus Listeria, with a circular chromosome of 2,814,130 base pairs and 2,780 open reading frames . The genome has a low G+C content (36.4%), which gives its DNA a less rigid structure . Compared to pathogenic Listeria species, L. welshimeri lacks several virulence-associated genes and genomic regions, including the entire virulence gene cluster known as "vgc" or Listeria pathogenicity island 1 (LIPI-1) .

What are the biochemical and morphological characteristics of L. welshimeri?

L. welshimeri bacteria are small (0.5 to 2.0 μm), non-spore-forming, and are motile below 30°C via peritrichous flagella that uniformly cover the cell surface . The organism can grow at low temperatures (4°C) within 5 days. L. welshimeri tests negative for oxidase activity and in the CAMP test with Staphylococcus aureus and Rhodococcus equi, but is positive for catalase activity. It can produce acid from the fermentation of D-xylose and α-methyl-D-mannoside but not from L-rhamnose and D-mannitol . These biochemical properties are used to differentiate L. welshimeri from other Listeria species in laboratory settings.

What is the UPF0266 membrane protein lwe0739 and what is its amino acid composition?

The lwe0739 protein is classified as a UPF0266 family membrane protein found in Listeria welshimeri serovar 6b. It consists of 155 amino acids with the following sequence:

MTWDATNIFLLVANILTILYILYNDAVIPLWKGKTVLTVKLRSRGRWDGYIFVGIIALLF ISNTFFREGPQLTSILLAVMGILFIYICFFRSSKAVFKETGLFYALLFFPYSKIERMNLS EDGILVIETNRQRLMLFARSEKDLEKMLAVFTKYN

This protein is encoded by the lwe0739 gene in the L. welshimeri genome. The protein's function is not fully characterized, which is typical for proteins designated with the UPF (Uncharacterized Protein Family) prefix.

What expression systems are optimal for producing recombinant L. welshimeri lwe0739 protein?

Based on the available data, E. coli expression systems have been successfully used to produce recombinant lwe0739 protein . For optimal production, the full-length sequence (amino acids 1-155) is typically cloned into an expression vector with an N-terminal His-tag to facilitate purification. While the specific E. coli strain is not detailed in the search results, commonly used strains for membrane protein expression include BL21(DE3), C41(DE3), and C43(DE3), which are engineered to tolerate the potentially toxic effects of overexpressed membrane proteins.

When designing expression protocols, researchers should consider:

• Induction conditions (IPTG concentration, temperature, and duration)

• Membrane protein solubilization methods

• Purification strategies compatible with the fusion tag

What are the recommended storage and handling conditions for recombinant lwe0739 protein?

For long-term storage, the recombinant lwe0739 protein should be stored at -20°C to -80°C, preferably with 5-50% glycerol (with 50% being the default concentration) to prevent protein degradation . The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use .

Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity . Before opening, vials containing the protein should be briefly centrifuged to bring the contents to the bottom.

What buffer systems are appropriate for maintaining lwe0739 protein stability?

The recombinant lwe0739 protein is typically stored in Tris/PBS-based buffer at pH 8.0 with 6% trehalose or in Tris-based buffer with 50% glycerol . These buffer compositions help maintain protein stability and prevent aggregation. When designing experiments, researchers should consider that membrane proteins often require specialized buffer systems that mimic the native membrane environment or include detergents to maintain solubility.

How does L. welshimeri compare to pathogenic Listeria species in virulence studies?

Compared to pathogenic Listeria species, L. welshimeri shows significantly reduced virulence. In a zebrafish larvae model, L. welshimeri strains showed the highest survival rate (83.0%) compared to L. monocytogenes (46.5%) and L. innocua (64.2%) . When examined for virulence genes using multiplex PCR, L. welshimeri was found to contain only a few virulence-related genes compared to L. monocytogenes, which possesses the majority of tested virulence genes (luxS, actA2, prfA, inlB, rrn, iap, sigB, plcB, actA, hlyA) .

The reduced virulence of L. welshimeri is primarily due to the absence of genes involved in virulence and "fitness" genes required for intracellular survival. Specifically, comparative genomic analysis reveals that the L. welshimeri genome lacks 482 genes present in L. monocytogenes, including deleted surface-associated proteins with leucine-rich repeat (LRR) and LPXTG motifs, which are required for adhering to and invading nonphagocytic cells .

What is known about fibronectin-binding properties in L. welshimeri?

L. welshimeri possesses a DNA fragment homologous to the fibronectin-binding protein-encoding gene (fbp) of L. monocytogenes. This L. welshimeri DNA fragment expresses a 24.8-kDa protein that binds to human fibronectin . The predicted 215-amino-acid sequence encoded by this fragment shares 90.7% amino acid identity with the Fbp protein of L. monocytogenes and retains key features such as:

• Rich lysine content (11.6%) distributed throughout the molecule

• AKTK repeated amino acid blocks in the middle of the protein (positions 99-102 and 170-173)

• A cytochrome c family heme-binding signature at positions 156-161

When expressed as a fusion protein with glutathione-S-transferase (GST), the recombinant protein demonstrates binding to human fibronectin, suggesting functional conservation despite the non-pathogenic nature of L. welshimeri .

How can recombinant lwe0739 be used in comparative studies with other Listeria membrane proteins?

Recombinant lwe0739 can serve as a valuable tool for comparative studies with membrane proteins from pathogenic Listeria species. Researchers can:

• Perform structural comparisons to identify conserved domains or motifs that might indicate shared functions

• Compare protein-protein interactions to understand differences in membrane protein complexes

• Conduct comparative binding assays to identify differential interactions with host factors

• Use the protein in immunological studies to detect cross-reactivity of antibodies against Listeria species

Such comparative approaches can help elucidate the evolutionary relationships between Listeria species and potentially identify factors that contribute to pathogenicity in L. monocytogenes versus non-pathogenicity in L. welshimeri.

What PCR-based methods are effective for specific identification of L. welshimeri?

PCR-based methods have been developed for the specific identification of L. welshimeri. One such method targets the fibronectin-binding protein gene (fbp) homolog in L. welshimeri . Using primer pairs G398 (5'-TGAAAGAGTTTATCGAGCCATACC-3') and G399 (5'-TTTATGGCCTTCTAGCACGTTCG-3'), researchers can specifically amplify a 170-bp DNA fragment from L. welshimeri chromosomal DNA.

This PCR assay has been validated against 15 strains of L. welshimeri and 20 strains of L. monocytogenes with no false positives or negatives, demonstrating high specificity for L. welshimeri . The PCR conditions typically involve:

• Initial denaturation at 94°C for 5 minutes

• 35 cycles of: denaturation at 94°C for 30 seconds, annealing at 60°C for 30 seconds, extension at 72°C for 30 seconds

• Final extension at 72°C for 5 minutes

For multiplex PCR assays targeting multiple Listeria species, researchers have used the following reaction mixture: 12.5 μL of 2x red Taq master mix, 5 μL nuclease-free water, 5 μL DNA template, and 4 μL of 20 μM primer mix .

What experimental models are appropriate for studying the function of lwe0739?

While the specific function of lwe0739 is not well-characterized in the provided search results, researchers can employ several experimental models to elucidate its role:

• Membrane protein topology analysis: Using methods like PhoA fusion or cysteine scanning mutagenesis to determine the membrane orientation of lwe0739.

• Protein-protein interaction studies: Techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or pull-down assays to identify interaction partners.

• Gene knockout or knockdown experiments: Creating lwe0739 deletion mutants in L. welshimeri to observe phenotypic changes.

• Heterologous expression systems: Expressing lwe0739 in different bacterial hosts to observe effects on membrane properties or cellular physiology.

• In silico structural prediction and modeling: Using computational approaches to predict protein structure and potential binding sites.

For in vivo studies, the zebrafish larvae model has been successfully used to study Listeria virulence and could potentially be adapted to investigate the role of specific membrane proteins like lwe0739 .

What methodological considerations are important when comparing genomes of pathogenic and non-pathogenic Listeria species?

When conducting comparative genomic analyses between pathogenic and non-pathogenic Listeria species, researchers should consider:

What are the challenges in characterizing the function of UPF0266 family proteins like lwe0739?

UPF (Uncharacterized Protein Family) proteins like lwe0739 present several research challenges:

• Limited homology: Few characterized homologs exist to provide functional insights through sequence comparison.

• Membrane localization: As a membrane protein, lwe0739 presents technical difficulties in purification, crystallization, and functional studies.

• Expression challenges: Membrane proteins often express poorly in heterologous systems and may form inclusion bodies or disrupt host cell membranes.

• Functional redundancy: Potential redundancy with other membrane proteins may mask phenotypic effects in knockout studies.

• Limited tools: Fewer genetic tools are available for manipulation of L. welshimeri compared to model organisms.

How might studies of lwe0739 contribute to our understanding of bacterial membrane biology?

Research on lwe0739 could advance our understanding of bacterial membrane biology in several ways:

• Membrane protein evolution: Comparative studies between lwe0739 and homologs in other bacteria could reveal evolutionary patterns in membrane protein development.

• Non-pathogenic adaptation: Understanding how membrane proteins function in non-pathogenic Listeria species could reveal adaptations specific to environmental versus host-associated lifestyles.

• Novel membrane protein families: Characterization of UPF0266 family proteins could establish new paradigms in membrane protein function.

• Bacterial physiology: Identifying the role of lwe0739 may reveal previously unknown aspects of bacterial membrane physiology or homeostasis.

What emerging technologies might facilitate better characterization of membrane proteins like lwe0739?

Several emerging technologies hold promise for advancing research on membrane proteins like lwe0739:

• Cryo-electron microscopy: This technique allows structural determination of membrane proteins without crystallization.

• Native mass spectrometry: Enables analysis of intact membrane protein complexes in their native or near-native states.

• Advanced computational modeling: Machine learning approaches can predict protein structures and functions with increasing accuracy.

• Nanodiscs and membrane mimetics: These provide more native-like environments for studying membrane proteins outside of cells.

• CRISPR-based techniques: Newer gene editing tools can facilitate more precise genetic manipulation of L. welshimeri.

• Single-cell techniques: Methods to study membrane protein localization and dynamics in individual bacterial cells provide higher resolution data than population-based approaches.