Recombinant Lithobates berlandieri Probable glutamate receptor

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Probable glutamate receptor; Kainate-binding protein; KBP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-487
Protein Length
Full Length of Mature Protein
Species
Lithobates berlandieri (Rio Grande leopard frog) (Rana berlandieri)
Target Protein Sequence
HTDGKENAETLLKERTKRQIPKTLTVTTILEKPFAMKTESDALEGYAIDLLSELTQSLGF NYTLHIVKDGKYGSKDQEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTG IGILLKKDTAAESSYMFGFLNPFSKELWIGIIISYVITSLCLFLVGRLSPCEWTEPASEQ NQFTLLNSLWYGVGALTLQGAEPQPKALSARIIAVIWWVFSITLLAAYIGSFASYINSNT NQTPNIQSVEDLLKQDKLDFGTLSNSSTLNFFKNSKNPTFQMIYEYMDKRKDRVLVKTFS EGVQRVRESNYAFLGESISQDFVVAKHCDLIRAPEMIGGRGYGIAAELDSPLIRPLTIAI LELFESGKLEYLRQKWWENTCSTQDQTGWVPVQPHTLGGIFLILGIGLALGLIVSFMELM CKSRSNAEQQKKSCCSAFSEEIAQRFGKTQNQEGLEKKSPTSNSCDEVKA
Uniprot No.

Target Background

Function

Recombinant Lithobates berlandieri Probable Glutamate Receptor: This receptor binds glutamate, an excitatory neurotransmitter crucial for numerous central nervous system synapses. Glutamate's postsynaptic effects are mediated by various receptors, classified based on their selective agonists.

Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What are glutamate receptors and how are they characterized in amphibian species like Lithobates berlandieri?

Glutamate receptors are membrane proteins that respond to the neurotransmitter glutamate and play critical roles in neurotransmission across various species. In amphibians, these receptors function similarly to those in mammals but may exhibit species-specific structural variations that affect their pharmacological properties. Glutamate receptors are classified into ionotropic (ion channel-forming) and metabotropic (G-protein coupled) receptors, with ionotropic receptors further subdivided into NMDA, AMPA, and kainate subtypes based on their pharmacological profiles and structural characteristics . In Lithobates species, glutamate receptors are involved in various physiological processes including neurotransmission, development, and potentially immune responses, similar to what has been observed in other amphibians such as Xenopus laevis .

How do glutamate receptor expression patterns differ across developmental stages in Lithobates berlandieri?

Glutamate receptor expression in amphibians shows distinct temporal and spatial patterns across developmental stages from tadpole to adult. Research in related amphibian species indicates that glutamate receptor expression and function undergo significant changes during metamorphosis, paralleling the substantial reorganization of the nervous system . During early development, blocking AMPA and NMDA type glutamate receptors significantly decreases spontaneous activity in young Xenopus retina, suggesting these receptors are functionally important even in early developmental stages . The transition from aquatic to terrestrial life in frogs like Lithobates berlandieri likely involves reprogramming of glutamate receptor expression patterns to accommodate changing environmental sensory inputs and physiological requirements.

What are the optimal expression systems for producing functional recombinant Lithobates berlandieri glutamate receptors?

The selection of an appropriate expression system is critical for successful production of functional recombinant amphibian glutamate receptors. Xenopus oocytes represent a particularly suitable heterologous expression system for amphibian proteins due to their phylogenetic relatedness and cellular environment that supports proper protein folding and post-translational modifications of amphibian membrane proteins. Mammalian cell lines such as HEK293 or COS-7 can also be effective, though they may require optimization of codon usage and temperature conditions to maximize expression of amphibian proteins. For structural studies requiring larger protein quantities, insect cell expression systems using baculovirus vectors offer scalable production capabilities. Success in expression typically requires careful optimization of the signal peptide sequence, often by using chimeric constructs incorporating mammalian signal peptides fused to the amphibian receptor sequence.

How can electrophysiological techniques be applied to characterize recombinant Lithobates berlandieri glutamate receptors?

Electrophysiological characterization of recombinant amphibian glutamate receptors requires specialized approaches adapted to their unique properties. Patch-clamp techniques similar to those used in salamander cone photoreceptor studies provide valuable insights into channel conductance, ion selectivity, and gating kinetics . Voltage-clamp recordings can determine reversal potential, which for amphibian glutamate-gated channels is typically near the equilibrium potential for Cl- . Important parameters to measure include single-channel conductance (which can be estimated through noise analysis of glutamate-elicited current fluctuations), open time, and response to pharmacological agents such as specific chloride channel blockers . The dependence of current magnitude on both internal and external Na+ and K+ concentrations should be assessed to understand the relationship between channel activity and ion gradients .

What signaling pathways are activated downstream of Lithobates berlandieri glutamate receptors?

Glutamate receptor activation initiates complex signaling cascades that vary depending on receptor subtype and cellular context. In amphibians, glutamate receptor signaling pathways likely parallel those in other vertebrates while exhibiting species-specific adaptations. Ionotropic glutamate receptors primarily signal through calcium influx, which can activate calcium-dependent enzymes including CaMKII and various protein kinases. Metabotropic glutamate receptors couple to G-proteins that modulate second messenger systems such as cAMP and phospholipase C pathways. In plants, glutamate receptor-like genes have been implicated in defense against pathogens, reproduction, and light signal transduction, suggesting evolutionary conservation of certain signaling functions . Particularly notable is the role of GLR channels in mediating calcium signals that regulate gene expression, including transcription factors essential for development .

How have glutamate receptor genes evolved in the Lithobates genus compared to other vertebrates?

Evolutionary analysis of glutamate receptor genes reveals complex patterns of conservation and divergence across vertebrate lineages. While the core functional domains remain highly conserved, sequence variations in ligand-binding regions and transmembrane domains contribute to species-specific pharmacological profiles. The glutamate receptor gene family in amphibians likely underwent expansion during vertebrate evolution, similar to the pattern observed in plants where angiosperm genomes contain 20 to 70 GLR genes . Phylogenetic studies of related amphibian species such as Lithobates onca and Lithobates yavapaiensis reveal close relationships but distinct genetic features, suggesting similar patterns might exist in glutamate receptor genes across the Lithobates genus . Interestingly, the functional role of glutamate receptor-like genes in mediating sperm chemotaxis appears to be conserved between early land plants and animals, pointing to ancient evolutionary origins of certain glutamate receptor functions .

What are the recommended protocols for cloning glutamate receptor genes from Lithobates berlandieri?

Cloning glutamate receptor genes from Lithobates berlandieri tissue requires careful optimization of RNA extraction and cDNA synthesis protocols. Begin with fresh tissue samples from brain, spinal cord, or retina preserved in RNAlater or flash-frozen in liquid nitrogen to maintain RNA integrity. Total RNA extraction should employ methods that minimize RNase contamination, followed by DNase treatment to remove genomic DNA. For first-strand cDNA synthesis, use reverse transcriptase with high thermostability and processivity, along with oligo(dT) primers or gene-specific primers designed based on conserved regions identified through multiple sequence alignment of glutamate receptor genes from related amphibian species.

PCR amplification strategies should include:

  • Degenerate PCR using primers targeting highly conserved domains of glutamate receptors

  • Rapid amplification of cDNA ends (RACE) to obtain full-length sequences

  • High-fidelity DNA polymerases to minimize introduction of mutations

  • Touchdown PCR protocols to improve specificity while accommodating primer degeneracy

For difficult templates with high GC content or secondary structures, additives such as DMSO (5-10%), betaine (1-2M), or specialized PCR enhancer solutions can improve amplification efficiency.

What purification strategies yield functional recombinant glutamate receptors for structural studies?

Purification of functional recombinant glutamate receptors presents significant challenges due to their multi-pass transmembrane nature. A systematic approach combining detergent screening and stability optimization is essential for successful purification. The following protocol has proven effective for related membrane proteins:

  • Initial Extraction: Screen a panel of mild detergents including DDM, LMNG, GDN, and digitonin at various concentrations to identify optimal solubilization conditions that maintain receptor functionality.

  • Affinity Purification: Incorporate affinity tags (His8, FLAG, or Strep-II) at termini predicted to be accessible, followed by single-step or tandem affinity chromatography.

  • Stability Assessment: Evaluate protein stability using fluorescence-detection size exclusion chromatography (FSEC) with a panel of buffers varying in pH (6.0-8.0), salt concentration (100-500 mM NaCl), and glycerol content (0-20%).

  • Ligand Stabilization: Include glutamate and/or receptor-specific antagonists during purification to stabilize specific conformational states.

  • Size Exclusion Chromatography: As a final polishing step, perform SEC to isolate homogeneous receptor preparations and assess oligomeric state.

For cryo-EM studies, reconstitution into nanodiscs or amphipols can improve sample homogeneity and preserve native-like lipid environments critical for maintaining receptor function.

What functional assays can reliably measure activity of recombinant Lithobates berlandieri glutamate receptors?

Multiple complementary approaches can be employed to assess the functionality of recombinant glutamate receptors from Lithobates berlandieri:

Calcium Flux Assays:

  • Load cells expressing recombinant receptors with calcium-sensitive fluorescent dyes (Fura-2, Fluo-4)

  • Monitor fluorescence changes upon glutamate application using plate readers or fluorescence microscopy

  • Calculate EC50 values for glutamate and various agonists

  • Data typically presented as normalized fluorescence (F/F0) versus time or agonist concentration

Electrophysiology:

  • Whole-cell patch-clamp recording provides direct measurement of channel activity

  • Two-electrode voltage clamp for Xenopus oocyte expression systems

  • Assess ion selectivity by measuring reversal potentials at different ion concentrations

  • Determine single-channel properties through outside-out patch recordings and noise analysis

Binding Assays:

  • Radioligand binding with [³H]-glutamate or [³H]-AMPA to determine affinity constants

  • Competition binding with various ligands to establish pharmacological profiles

  • Scatchard analysis to determine receptor density and binding site characteristics

Assay TypePrimary MeasurementAdvantagesLimitations
Calcium FluxIntracellular Ca²⁺ concentrationHigh throughput, real-time kineticsIndirect measure, requires Ca²⁺-permeable channels
Patch ClampIon currentDirect functional measurement, high temporal resolutionLow throughput, technically demanding
Radioligand BindingBinding affinity (Kd, Ki)Quantitative, no expression system neededNo functional information, requires radioactivity
Surface Plasmon ResonanceBinding kinetics (kon, koff)Label-free, real-time association/dissociationRequires highly purified protein, indirect functional measure

How can protein-protein interactions involving glutamate receptors be identified and characterized in amphibian systems?

Investigating protein-protein interactions of amphibian glutamate receptors requires specialized approaches that account for the unique cellular environment of amphibian tissues. Several complementary techniques can be employed:

Co-immunoprecipitation (Co-IP):
Using antibodies against native Lithobates glutamate receptors or epitope tags on recombinant receptors, followed by mass spectrometry analysis to identify interacting partners. This approach has revealed interactions between glutamate receptors and various scaffolding proteins, signaling molecules, and trafficking regulators in other species. For amphibian-specific studies, tissue lysis conditions require careful optimization, typically using buffers containing 1% digitonin or 0.5-1% n-dodecyl-β-D-maltoside to maintain native protein interactions.

Proximity Labeling:
Techniques such as BioID or APEX2 can identify the proximal proteome of glutamate receptors. By fusing these enzymes to glutamate receptor subunits and expressing them in amphibian cell lines or primary cultures, researchers can map the local protein environment through biotinylation of nearby proteins followed by streptavidin pulldown and mass spectrometry.

Förster Resonance Energy Transfer (FRET):
Live-cell imaging using fluorescent protein-tagged glutamate receptors and putative interacting proteins can reveal dynamic interactions in real time. This technique is particularly valuable for studying activity-dependent changes in protein interactions following receptor activation by glutamate or pharmacological agents.

How can recombinant Lithobates berlandieri glutamate receptors contribute to understanding amphibian nervous system evolution?

Recombinant glutamate receptors from Lithobates berlandieri represent valuable tools for investigating the evolutionary history of vertebrate neurotransmission systems. Comparative analysis of these receptors with those from fish, reptiles, birds, and mammals can reveal key adaptations that emerged during the transition to terrestrial life. Amphibians occupy a pivotal evolutionary position, having diverged from the tetrapod lineage approximately 350 million years ago, making their glutamate receptors particularly informative for tracing the diversification of vertebrate nervous systems .

Functional characterization of recombinant Lithobates glutamate receptors can provide insights into: (1) evolutionary changes in ligand specificity and ion selectivity, (2) diversification of regulatory mechanisms controlling receptor expression and trafficking, and (3) structural adaptations that may correlate with ecological niches and sensory specializations. For instance, the finding that glutamate-elicited currents in salamander retina possess properties of both chloride channels and glutamate transporters suggests unique adaptations possibly related to visual processing in amphibian environments .

What role do glutamate receptors play in amphibian metamorphosis and developmental plasticity?

Glutamate receptors likely play crucial regulatory roles during the dramatic remodeling of amphibian nervous systems during metamorphosis. Studies in Xenopus have shown that blocking AMPA and NMDA glutamate receptors significantly affects spontaneous activity in the developing retina, suggesting these receptors are essential for proper neural circuit formation . The transition from aquatic to terrestrial life requires substantial reorganization of sensory systems, motor circuits, and autonomic functions—processes that depend on activity-dependent plasticity mediated in part by glutamate receptors.

Research directions for investigating the developmental roles of Lithobates glutamate receptors include:

  • Stage-specific expression profiling using qRT-PCR and in situ hybridization to map receptor subtype distribution changes during metamorphosis

  • Pharmacological interventions using subtype-specific antagonists to assess functional requirements during critical developmental windows

  • Characterization of metamorphosis-associated changes in glutamate receptor electrophysiological properties and signaling pathways

  • Integration with thyroid hormone signaling pathways, which orchestrate amphibian metamorphosis and may regulate glutamate receptor expression

What is the potential of Lithobates berlandieri glutamate receptors as models for understanding human neurological disorders?

Amphibian glutamate receptors can serve as valuable models for investigating human neurological disorders involving glutamatergic dysfunction. Recombinant Lithobates receptors offer several advantages for such research, including their evolutionary relationship to human receptors combined with distinctive properties that can illuminate structure-function relationships relevant to disease mechanisms. Glutamate receptor dysfunction has been implicated in numerous neurological conditions including epilepsy, neurodegenerative diseases, psychiatric disorders, and stroke.

Specific research applications include:

  • Epilepsy research: Amphibian models can help elucidate the role of glutamate receptor subtypes in seizure generation and propagation. The simplified neural circuits of amphibians facilitate investigation of network-level effects of receptor modulation.

  • Excitotoxicity mechanisms: Calcium-permeable glutamate receptors contribute to excitotoxic cell death in various pathological conditions. The finding that plant GLR channels regulate calcium signaling and gene expression suggests evolutionary conservation of these pathways , making amphibian models relevant for studying fundamental mechanisms of excitotoxicity.

  • Drug discovery platforms: Recombinant Lithobates glutamate receptors can be used in high-throughput screening assays to identify novel compounds with therapeutic potential for neurological disorders, potentially revealing binding sites and mechanisms not evident in mammalian receptors.

  • Evolutionary medicine: Comparing human and amphibian glutamate receptor properties can highlight which features have been conserved over hundreds of millions of years of evolution, potentially identifying critical functional domains that might represent robust targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.