Recombinant Lithobates catesbeiana Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development with the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
Target Names
RHO
Target Protein Sequence
MNGTEGPNFYVPMSNKTGIVRSPFEYPQYYLAEPWKYSVLAAYMFLLILLGLPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTITMYTSLHGYFVFGQTGCYFEGFFATLG GEIALWSLVVLAIERYIVVCKPMSNFRFGENHAMMGVAFTWIMALACAVPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFLIPLIIISFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVVIMVIFFLICWVPYAYVAFYIFTHQGSEFGPIFMTVPAFFAKSSAI YNPVIYIMLNKQFRNCMITTLCCGKNPFGDEDASSAATSKTEATSVSTSQVSPA
Uniprot No.

Target Background

Function
Photoreceptor required for image-forming vision at low light intensity. Essential for photoreceptor cell viability after birth. May utilize a mixture of retinal and 3-dehydroretinal as its visual pigment. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, thereby terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Tissue Specificity
Retina. Localized in the ventral part of the retina.

Q&A

Basic Research Questions

  • What is the molecular structure and characteristics of Lithobates catesbeiana Rhodopsin?

    Lithobates catesbeiana Rhodopsin (RHO) is a 354-amino acid transmembrane protein expressed in rod photoreceptor cells. The full-length protein sequence includes characteristic GPCR domains with seven transmembrane regions. Unlike bovine rhodopsin (which focuses at pH 6.2), frog rhodopsin exhibits a more complex isoelectric focusing pattern with bands at pH 8.8, 8.1, and 8.0, indicating structural differences that may relate to its function in amphibian visual systems . The protein has a molecular weight of approximately 34.7-37.0 kDa as determined by SDS-PAGE analysis, with two closely-spaced bands observed in R. pipiens that are also present in R. catesbeiana . The amino acid sequence contains multiple functional domains essential for light detection and signal transduction .

  • How is recombinant Lithobates catesbeiana Rhodopsin typically expressed and purified for research applications?

    The expression and purification of recombinant Lithobates catesbeiana Rhodopsin typically involves:

    Expression SystemPurification MethodTag SystemAdditional Steps
    E. coliAffinity chromatographyN-terminal His tagSolubilization with detergents

    The recombinant protein is commonly expressed in E. coli bacterial systems with an N-terminal His-tag to facilitate purification . After expression, the protein is typically isolated through affinity chromatography and delivered as a lyophilized powder with >90% purity as determined by SDS-PAGE . For experimental applications, the protein is reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, often with 5-50% glycerol addition for long-term storage stability .

  • What are the optimal storage and handling conditions for maintaining the activity of recombinant Lithobates catesbeiana Rhodopsin?

    For optimal preservation of recombinant Lithobates catesbeiana Rhodopsin activity:

    The protein should be stored at -20°C to -80°C upon receipt, with appropriate aliquoting to avoid repeated freeze-thaw cycles which can significantly degrade activity . The recommended storage buffer typically consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0 . For working solutions, aliquots can be maintained at 4°C for up to one week . When reconstituting from lyophilized form, it's advisable to briefly centrifuge the vial before opening to ensure all material is at the bottom. Addition of 5-50% glycerol (with 50% being standard) to reconstituted protein significantly enhances stability during long-term storage . The reconstitution procedure should be performed using deionized sterile water to avoid contamination that could affect protein integrity.

  • What techniques are commonly employed to assess the purity and integrity of recombinant Lithobates catesbeiana Rhodopsin preparations?

    Multiple complementary techniques are employed to evaluate recombinant RHO quality:

    SDS-PAGE analysis remains the primary method for assessing purity, with quality preparations showing >90% homogeneity . For amphibian rhodopsins specifically, researchers should anticipate observing characteristic closely-spaced bands (34.7 and 37.0 kDa for R. pipiens, with similar patterns for R. catesbeiana) . Isoelectric focusing provides additional quality assessment, with frog rhodopsin exhibiting distinctive focusing patterns compared to bovine rhodopsin . In specialized research contexts, functional assessment through light-dependent phosphorylation can verify biological activity, as both molecular weight variants of frog rhodopsin demonstrate phosphorylation when exposed to light following incubation with 32Pi . Advanced methodologies such as spectral analysis can confirm proper chromophore binding and photoresponse characteristics.

Experimental Methodology Focus

  • What methodological approaches can be used to study the phosphorylation patterns of Lithobates catesbeiana Rhodopsin under different light conditions?

    For studying light-dependent phosphorylation of frog rhodopsin:

    Established protocols involve incubating isolated retinas with 32Pi followed by light exposure . After this treatment, rhodopsin can be purified and analyzed by SDS-PAGE and autoradiography to detect incorporated phosphate groups. Both the 34.7 and 37.0 kDa molecular weight variants of frog rhodopsin have been found to be phosphorylated under these conditions . For more detailed analysis, phosphopeptide mapping combined with mass spectrometry can identify specific phosphorylation sites. Time-course experiments exposing rhodopsin to varying light intensities and durations can reveal the kinetics of phosphorylation. Comparison of phosphorylation patterns between species (e.g., R. pipiens versus R. catesbeiana) or between different rhodopsin bands (I, IIa, and IIb) separated by isoelectric focusing can provide insights into functional variations . Reconstitution of purified rhodopsin with rhodopsin kinase in artificial membranes allows for controlled studies of phosphorylation mechanisms. Modern approaches might include phospho-specific antibodies or fluorescent phospho-sensors to monitor phosphorylation events in real-time.

  • How can single-molecule tracking techniques be optimized for studying Lithobates catesbeiana Rhodopsin dynamics in native disc membranes?

    Optimizing single-molecule tracking for frog rhodopsin requires:

    The use of mechanically fragmented rod outer segments (f-ROSs) from frog photoreceptors provides suitable disc membranes (~8 μm in diameter) for single-molecule studies . For specific labeling, the Fab' fragment of anti-rhodopsin monoclonal antibody 1D4 (Fab'-1D4) conjugated with near-IR dyes has proven effective . Illumination with highly inclined laser beams (750-nm wavelength) on a total internal reflection fluorescence microscope (TIRFM) enables visualization of single-molecule fluorescent spots while minimizing photodamage . Sophisticated analysis using variational Bayes hidden Markov model (HMM) analysis helps infer diffusive states and transition rates, revealing dynamic clustering behavior . For separation of f-ROSs after labeling, Percoll density-gradient centrifugation (34,000 × g for 5 min at 4°C) with specific Percoll concentrations (44%, 40%, and 26%) provides optimal purification . For studies of rhodopsin interactions with other proteins, specially labeled partners can be prepared, such as HiLyte Fluor 750-C2 maleimide-labeled Gαt . Temperature control during experiments is critical, with samples typically maintained at 0°C in light-tight containers until use .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.