Recombinant Lithognathus mormyrus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

The protein is produced in E. coli with the following specifications :

  • Storage: Short-term at -20°C; long-term at -80°C.

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week.

  • Purity: Full-length protein confirmed via SDS-PAGE and mass spectrometry.

The amino acid sequence begins:
MNGTEGPYFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY...

Phototransduction Studies

  • Activation mechanism: Light-induced isomerization of 11-cis-retinal to all-trans-retinal triggers conformational changes in Helix 6 (residues Lys246–His276), enabling G protein (transducin) binding .

  • Structural dynamics: Pro267 in Helix 6 creates a 36° kink, critical for signal transduction .

Disease Modeling

  • Retinitis pigmentosa (RP): Over 150 RHO mutations cause autosomal dominant RP (adRP) . While Lithognathus mormyrus rhodopsin is not directly linked to human disease, its recombinant form aids in studying:

    • Misfolding pathologies: Class II mutants (e.g., P23H) disrupt endoplasmic reticulum (ER) trafficking, activating stress kinases (p38, JNK) and apoptosis .

    • Therapeutic screening: Pharmacological chaperones like YC-001 rescue trafficking defects in ~60% of mutants .

Table 2: Mutation Classes in Rhodopsin-Related adRP

ClassTraffickingChromophore BindingClinical Impact
INormalYesMild, late-onset degeneration
IIER-retainedNoSevere, early-onset RP

Therapeutic Developments

Recent advances targeting RHO mutations include:

  • RNA replacement therapy: AAV-delivered ribozymes (e.g., RZ-004) edit mutant RHO mRNA, restoring wild-type expression .

  • CRISPR-based editing: Allele-independent suppression of mutant RHO combined with wild-type supplementation .

Limitations and Future Directions

  • Species-specific variability: Marine adaptations in Lithognathus mormyrus rhodopsin may limit direct translational relevance to human therapies.

  • Functional assays: Further studies are needed to characterize its G protein coupling efficiency compared to mammalian rhodopsins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Lithognathus mormyrus (Striped seabream) (Sparus mormyrus)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWLMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLMVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLICWCPYAGVAWWIFTHQGSDFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Recombinant Lithognathus mormyrus Rhodopsin (rho) and how does it differ from mammalian rhodopsins?

Recombinant Lithognathus mormyrus Rhodopsin (rho) is a G-protein coupled receptor protein expressed in rod cells of the striped seabream retina. Like other rhodopsins, it functions as a primary photoreceptor molecule consisting of an opsin protein (348 amino acids with seven transmembrane domains) linked to a chromophore, 11-cis-retinal .

The key differences between fish rhodopsin and mammalian rhodopsins lie in their amino acid sequences and post-translational modifications, which affect spectral sensitivity, thermal stability, and signaling properties. Lithognathus mormyrus Rhodopsin shows evolutionary adaptations to the marine environment, with sequence variations particularly in the transmembrane domains and extracellular loops that influence its photochemical properties.

Methodology for comparative analysis:

  • Sequence alignment using BLAST or Clustal Omega

  • Structural modeling using homology-based prediction software

  • Spectroscopic analysis of absorption maxima

  • G-protein coupling efficiency assays

What are the optimal storage and handling conditions for Recombinant Lithognathus mormyrus Rhodopsin?

For maximum stability and activity retention, Recombinant Lithognathus mormyrus Rhodopsin requires specific storage conditions:

  • Store at -20°C for routine use or -80°C for extended storage periods

  • Use a Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Avoid repeated freeze-thaw cycles, which significantly reduce activity

  • For working solutions, maintain aliquots at 4°C for no longer than one week

The stability of rhodopsin is highly dependent on maintaining its native conformation. Experimental evidence suggests that zinc plays a crucial role in rhodopsin stability, though excess concentrations can actually reduce thermal stability and promote protein aggregation . Therefore, careful attention to buffer composition is essential.

Proper handling protocol includes:

  • Thaw frozen aliquots rapidly at room temperature

  • Keep the protein in the dark or under dim red light during experimentation

  • Add protease inhibitors to prevent degradation during longer experiments

  • Monitor protein integrity via SDS-PAGE before critical experiments

What experimental techniques are most effective for studying Recombinant Lithognathus mormyrus Rhodopsin function?

Several complementary techniques provide comprehensive functional characterization:

Spectroscopic Methods:

  • UV-Visible absorption spectroscopy to determine rhodopsin's spectral properties

  • Circular dichroism for secondary structure analysis

  • Fluorescence spectroscopy to monitor conformational changes upon photoactivation

Functional Assays:

  • GTPγS binding assays to measure G-protein activation

  • Calcium flux measurements to assess downstream signaling

  • Patch-clamp electrophysiology in expression systems

Structural Methods:

  • Cryo-electron microscopy for structural determination

  • X-ray crystallography (challenging but provides high-resolution data)

  • Molecular dynamics simulations based on homology models

Rhodopsin functions through a well-characterized signal transduction cascade. When light activates rhodopsin, it initiates the exchange of GDP for GTP on the G-protein transducin (Gtα), leading to increased cGMP hydrolysis through the PDE complex. This results in closure of cGMP-gated channels and hyperpolarization of the membrane potential .

How can Recombinant Lithognathus mormyrus Rhodopsin be used as a model system for studying G-protein coupled receptor signaling?

As a member of the G-protein coupled receptor (GPCR) family, Lithognathus mormyrus Rhodopsin serves as an excellent model system for studying GPCR signaling mechanisms:

  • Experimental Advantages:

    • Natural chromophore (11-cis-retinal) enables direct activation by light

    • Signal can be precisely controlled by light intensity and duration

    • Activation kinetics can be measured with millisecond precision

    • Expression in heterologous systems is relatively straightforward

  • Methodological Approach:

    • Express recombinant protein in appropriate cell lines (HEK293, CHO)

    • Reconstitute with 11-cis-retinal (typically 1-5μM) in dark conditions

    • Measure G-protein activation using FRET-based sensors

    • Analyze downstream signaling components using phosphorylation-specific antibodies

The rhodopsin-mediated signal transduction cascade involves a series of molecular events that can be individually probed: light absorption by rhodopsin, conformational changes in the protein, G-protein activation, and subsequent effector engagement . Each step provides insights into general GPCR mechanisms that apply across the receptor family.

What are the challenges in expressing functional Recombinant Lithognathus mormyrus Rhodopsin in heterologous systems?

Expression of fully functional Recombinant Lithognathus mormyrus Rhodopsin presents several technical challenges:

Membrane Insertion and Folding:

  • The seven transmembrane domain structure requires specialized chaperones

  • Expression often results in misfolded proteins that aggregate in the endoplasmic reticulum

  • Codon optimization for the expression system is critical (fish vs. mammalian codons)

Post-translational Modifications:

  • Glycosylation patterns differ between fish and common expression systems

  • Proper disulfide bond formation is essential for stability

  • Palmitoylation sites may be processed differently

Chromophore Integration:

  • Efficient reconstitution with 11-cis-retinal requires specific conditions

  • Light exposure during purification can lead to activation and destabilization

  • Monitoring chromophore:opsin ratio is essential for quality control

Optimization Strategies:

  • Use specialized expression vectors with appropriate signal sequences

  • Incorporate fusion tags that enhance membrane targeting (e.g., GPCR-GFP)

  • Reduce expression temperature (28°C instead of 37°C)

  • Add chemical chaperones to the culture medium

  • Establish stable cell lines rather than relying on transient expression

How can Recombinant Lithognathus mormyrus Rhodopsin be utilized in neurodegenerative disease research?

Rhodopsin has emerging potential as a biomarker for neurodegenerative diseases, making Recombinant Lithognathus mormyrus Rhodopsin valuable for comparative studies:

Research Applications:

  • Model System for Protein Misfolding:

    • Rhodopsin misfolding contributes to retinal degeneration mechanisms similar to those in neurodegenerative diseases

    • The zinc-binding site in rhodopsin provides insights into metal dysregulation observed in Alzheimer's disease

  • Biomarker Development Pipeline:

    • Fish rhodopsins can provide comparative data for human biomarker development

    • Conservation of key structural features enables cross-species validation

    • Antibodies generated against conserved epitopes may have cross-reactivity

  • Experimental Approach:

    • Generate mutant versions that mimic disease-associated changes

    • Study protein stability and aggregation propensity in vitro

    • Develop rhodopsin quantification assays that can be translated to clinical samples

Recent research has established correlations between retinal thinning and several neurodegenerative disorders including Alzheimer's disease, Parkinson's disease, and Huntington's disease . Rhodopsin levels decrease prior to retinal thinning, suggesting its potential as an early biomarker for these conditions.

What analytical methods are most effective for quantifying Recombinant Lithognathus mormyrus Rhodopsin levels in research samples?

Accurate quantification of rhodopsin levels is essential for both basic research and biomarker development:

MethodDetection LimitSample TypeAdvantagesLimitations
ELISA5-10 ng/mLTissue/cell extractsHigh throughput, specificRequires validated antibodies
Western Blot50-100 ng/mLProtein extractsSize verificationSemi-quantitative, time-consuming
cSLOIn situ detectionIntact retina/tissueNon-invasive, in vivo compatibleSpecialized equipment required
Mass Spectrometry1-5 ng/mLPurified/complex samplesAbsolute quantificationComplex sample preparation
Spectrophotometry0.5-1 μMPurified proteinSimple, directRequires purified protein

Confocal scanning laser ophthalmoscopy (cSLO) represents a novel technique that allows for rhodopsin quantification in intact tissues, potentially enabling early detection of neurodegenerative processes . This approach measures rhodopsin concentration by detecting changes in autofluorescence following photobleaching.

For recombinant protein analysis, combining multiple methods provides comprehensive validation:

  • Initial quantification by spectrophotometry (A280 and A500 ratio)

  • Confirmation by SDS-PAGE with densitometry

  • Functional validation using G-protein activation assays

How do specific mutations in Recombinant Lithognathus mormyrus Rhodopsin affect its biophysical properties?

Structure-function analysis through targeted mutations provides valuable insights:

Critical Residues for Analysis:

  • Retinal Binding Pocket:

    • Mutations in the binding pocket (particularly lysine at position 296 based on homology) eliminate chromophore attachment

    • Hydrogen bonding network mutations alter spectral properties and activation kinetics

  • G-protein Interaction Interface:

    • Mutations in cytoplasmic loops alter signaling efficiency

    • Conservative substitutions can create constitutively active or inactive variants

  • Transmembrane Helices:

    • Mutations affecting helix packing alter thermal stability

    • Proline substitutions can lock the protein in specific conformational states

Experimental Design for Mutation Analysis:

  • Generate mutations using site-directed mutagenesis

  • Express mutant proteins alongside wild-type controls

  • Characterize using thermal stability assays, spectroscopic methods, and functional assays

  • Correlate findings with structural models

Mutation analysis is particularly valuable when comparing fish rhodopsin with human variants implicated in diseases like retinitis pigmentosa, potentially revealing conserved mechanisms of protein destabilization and aggregation .

How can optogenetic applications be developed using Recombinant Lithognathus mormyrus Rhodopsin?

Optogenetics utilizes light-sensitive proteins to control cellular activity, with rhodopsins being critical components:

Development Strategy:

  • Engineering Considerations:

    • Modify the protein sequence to alter wavelength sensitivity

    • Create fusion constructs with fluorescent reporters

    • Optimize membrane trafficking signals for neuronal expression

  • Vector Design:

    • Select appropriate promoters for target cell specificity

    • Include regulatory elements for controlled expression

    • Incorporate purification tags for biochemical characterization

  • Validation Protocol:

    • Test expression in neuronal cultures before in vivo applications

    • Measure light-induced currents using patch-clamp electrophysiology

    • Characterize spectral sensitivity and kinetics

  • Comparative Advantages:

    • Fish rhodopsins may offer spectral diversity beneficial for multiplexed optogenetics

    • Potential differences in photocycle kinetics provide unique temporal control options

Microbial rhodopsins including channelrhodopsin have been extensively used in neuroscience research for manipulating membrane potentials using light energy . The rapid kinetics and structural simplicity of opsins make them ideal candidates for neuronal expression in optogenetic applications.

What purification strategies yield the highest quality Recombinant Lithognathus mormyrus Rhodopsin for structural studies?

Obtaining high-purity, functionally intact rhodopsin requires specialized purification approaches:

Purification Protocol:

  • Cell Lysis and Membrane Preparation:

    • Use detergent-free methods for initial cell disruption

    • Isolate membrane fractions through differential centrifugation

    • Perform all steps under dim red light to prevent photoactivation

  • Solubilization:

    • Select mild detergents (DDM, LMNG) at minimal effective concentrations

    • Include stabilizing agents (glycerol, cholesterol hemisuccinate)

    • Maintain temperature at 4°C throughout the process

  • Chromatography Sequence:

    • Affinity chromatography using antibodies or engineered tags

    • Size exclusion chromatography to remove aggregates

    • Optional: ion exchange chromatography for final polishing

  • Quality Control:

    • A280/A500 ratio assessment (ideally 1.6-1.8 for high purity)

    • Thermal stability measurements

    • SDS-PAGE and Western blot analysis

    • Functional assays (G-protein activation)

Maintaining protein stability during purification is critical, as retinal-bound rhodopsin is sensitive to light, temperature fluctuations, and detergent concentration. The rhodopsin must be kept in its stable dark state with 11-cis-retinal bound during the entire purification process to prevent conformation changes that lead to aggregation.

What experimental design considerations are important when using Recombinant Lithognathus mormyrus Rhodopsin for comparative evolutionary studies?

Evolutionary studies require careful experimental design:

Key Considerations:

  • Sequence Selection:

    • Include diverse species spanning evolutionary distances

    • Focus on conserved functional domains and variable regions

    • Use both closely related fish species and more distant vertebrates

  • Functional Equivalence Testing:

    • Express rhodopsins from multiple species under identical conditions

    • Compare spectral tuning properties across species

    • Measure G-protein coupling efficiency using consistent assays

  • Environmental Adaptation Analysis:

    • Correlate rhodopsin properties with species habitat (depth, water clarity)

    • Examine positive selection signatures in sequence data

    • Test thermal stability relative to species temperature ranges

  • Data Analysis Approach:

    • Apply phylogenetic correction for statistical comparisons

    • Use ancestral sequence reconstruction to identify key evolutionary transitions

    • Combine sequence, structural, and functional data in integrated analyses

Evolutionary comparisons can reveal how environmental pressures have shaped rhodopsin function, providing insights into molecular adaptation mechanisms that may be applicable to protein engineering for research or therapeutic applications.

How can Recombinant Lithognathus mormyrus Rhodopsin contribute to developing novel diagnostic tools for retinal disorders?

The relationship between rhodopsin and retinal health offers diagnostic opportunities:

Diagnostic Development Pathway:

  • Biomarker Validation:

    • Establish normal ranges for rhodopsin levels in fish and mammalian models

    • Correlate rhodopsin quantification with retinal thinning progression

    • Identify disease-specific patterns of rhodopsin degradation

  • Assay Development:

    • Optimize antibodies against conserved epitopes for cross-species detection

    • Develop non-invasive imaging protocols based on cSLO technology

    • Create standardized protocols for sample collection and processing

  • Clinical Translation Strategy:

    • Validate in animal models of retinal degeneration

    • Correlate findings with human patient samples

    • Perform comparative studies against existing diagnostic methods

Recent research has revealed that rhodopsin levels decrease prior to observable retinal thinning, suggesting its potential as an earlier biomarker for diagnosis . The development of confocal scanning laser ophthalmoscopy (cSLO) for quantifying rhodopsin represents a promising non-invasive diagnostic approach that could detect changes before structural alterations become apparent.

What is the significance of zinc interaction with Recombinant Lithognathus mormyrus Rhodopsin and how can it be experimentally investigated?

Zinc plays a crucial role in rhodopsin stability and function:

Experimental Investigation Approach:

  • Binding Characterization:

    • Isothermal titration calorimetry to measure binding affinity

    • Mutagenesis of predicted zinc coordination sites

    • Spectroscopic analysis of zinc-dependent conformational changes

  • Functional Impact Assessment:

    • Measure thermal stability as a function of zinc concentration

    • Analyze the effect of zinc on chromophore binding kinetics

    • Investigate zinc influence on photobleaching and regeneration cycles

  • Disease-Relevant Models:

    • Create conditions mimicking zinc dysregulation seen in neurodegenerative diseases

    • Examine rhodopsin aggregation propensity under varying zinc conditions

    • Test protective compounds that may stabilize rhodopsin-zinc interactions

Research has shown that mutations affecting the high-affinity zinc-binding site in rhodopsin contribute to visual changes seen in conditions like retinitis pigmentosa and potentially Alzheimer's disease . A delicate balance of zinc is required, as both deficiency and excess can be detrimental – zinc deficiency contributes to retinal neurodegeneration, while excess promotes protein aggregation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.