The protein is produced in E. coli with the following specifications :
Storage: Short-term at -20°C; long-term at -80°C.
Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week.
Purity: Full-length protein confirmed via SDS-PAGE and mass spectrometry.
The amino acid sequence begins:
MNGTEGPYFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY...
Activation mechanism: Light-induced isomerization of 11-cis-retinal to all-trans-retinal triggers conformational changes in Helix 6 (residues Lys246–His276), enabling G protein (transducin) binding .
Structural dynamics: Pro267 in Helix 6 creates a 36° kink, critical for signal transduction .
Retinitis pigmentosa (RP): Over 150 RHO mutations cause autosomal dominant RP (adRP) . While Lithognathus mormyrus rhodopsin is not directly linked to human disease, its recombinant form aids in studying:
| Class | Trafficking | Chromophore Binding | Clinical Impact |
|---|---|---|---|
| I | Normal | Yes | Mild, late-onset degeneration |
| II | ER-retained | No | Severe, early-onset RP |
Recent advances targeting RHO mutations include:
RNA replacement therapy: AAV-delivered ribozymes (e.g., RZ-004) edit mutant RHO mRNA, restoring wild-type expression .
CRISPR-based editing: Allele-independent suppression of mutant RHO combined with wild-type supplementation .
Species-specific variability: Marine adaptations in Lithognathus mormyrus rhodopsin may limit direct translational relevance to human therapies.
Functional assays: Further studies are needed to characterize its G protein coupling efficiency compared to mammalian rhodopsins.
Recombinant Lithognathus mormyrus Rhodopsin (rho) is a G-protein coupled receptor protein expressed in rod cells of the striped seabream retina. Like other rhodopsins, it functions as a primary photoreceptor molecule consisting of an opsin protein (348 amino acids with seven transmembrane domains) linked to a chromophore, 11-cis-retinal .
The key differences between fish rhodopsin and mammalian rhodopsins lie in their amino acid sequences and post-translational modifications, which affect spectral sensitivity, thermal stability, and signaling properties. Lithognathus mormyrus Rhodopsin shows evolutionary adaptations to the marine environment, with sequence variations particularly in the transmembrane domains and extracellular loops that influence its photochemical properties.
Methodology for comparative analysis:
Sequence alignment using BLAST or Clustal Omega
Structural modeling using homology-based prediction software
Spectroscopic analysis of absorption maxima
G-protein coupling efficiency assays
For maximum stability and activity retention, Recombinant Lithognathus mormyrus Rhodopsin requires specific storage conditions:
Store at -20°C for routine use or -80°C for extended storage periods
Use a Tris-based buffer with 50% glycerol, optimized for this specific protein
Avoid repeated freeze-thaw cycles, which significantly reduce activity
For working solutions, maintain aliquots at 4°C for no longer than one week
The stability of rhodopsin is highly dependent on maintaining its native conformation. Experimental evidence suggests that zinc plays a crucial role in rhodopsin stability, though excess concentrations can actually reduce thermal stability and promote protein aggregation . Therefore, careful attention to buffer composition is essential.
Proper handling protocol includes:
Thaw frozen aliquots rapidly at room temperature
Keep the protein in the dark or under dim red light during experimentation
Add protease inhibitors to prevent degradation during longer experiments
Monitor protein integrity via SDS-PAGE before critical experiments
Several complementary techniques provide comprehensive functional characterization:
Spectroscopic Methods:
UV-Visible absorption spectroscopy to determine rhodopsin's spectral properties
Circular dichroism for secondary structure analysis
Fluorescence spectroscopy to monitor conformational changes upon photoactivation
Functional Assays:
GTPγS binding assays to measure G-protein activation
Calcium flux measurements to assess downstream signaling
Patch-clamp electrophysiology in expression systems
Structural Methods:
Cryo-electron microscopy for structural determination
X-ray crystallography (challenging but provides high-resolution data)
Molecular dynamics simulations based on homology models
Rhodopsin functions through a well-characterized signal transduction cascade. When light activates rhodopsin, it initiates the exchange of GDP for GTP on the G-protein transducin (Gtα), leading to increased cGMP hydrolysis through the PDE complex. This results in closure of cGMP-gated channels and hyperpolarization of the membrane potential .
As a member of the G-protein coupled receptor (GPCR) family, Lithognathus mormyrus Rhodopsin serves as an excellent model system for studying GPCR signaling mechanisms:
Experimental Advantages:
Natural chromophore (11-cis-retinal) enables direct activation by light
Signal can be precisely controlled by light intensity and duration
Activation kinetics can be measured with millisecond precision
Expression in heterologous systems is relatively straightforward
Methodological Approach:
Express recombinant protein in appropriate cell lines (HEK293, CHO)
Reconstitute with 11-cis-retinal (typically 1-5μM) in dark conditions
Measure G-protein activation using FRET-based sensors
Analyze downstream signaling components using phosphorylation-specific antibodies
The rhodopsin-mediated signal transduction cascade involves a series of molecular events that can be individually probed: light absorption by rhodopsin, conformational changes in the protein, G-protein activation, and subsequent effector engagement . Each step provides insights into general GPCR mechanisms that apply across the receptor family.
Expression of fully functional Recombinant Lithognathus mormyrus Rhodopsin presents several technical challenges:
Membrane Insertion and Folding:
The seven transmembrane domain structure requires specialized chaperones
Expression often results in misfolded proteins that aggregate in the endoplasmic reticulum
Codon optimization for the expression system is critical (fish vs. mammalian codons)
Post-translational Modifications:
Glycosylation patterns differ between fish and common expression systems
Proper disulfide bond formation is essential for stability
Palmitoylation sites may be processed differently
Chromophore Integration:
Efficient reconstitution with 11-cis-retinal requires specific conditions
Light exposure during purification can lead to activation and destabilization
Monitoring chromophore:opsin ratio is essential for quality control
Optimization Strategies:
Use specialized expression vectors with appropriate signal sequences
Incorporate fusion tags that enhance membrane targeting (e.g., GPCR-GFP)
Reduce expression temperature (28°C instead of 37°C)
Add chemical chaperones to the culture medium
Establish stable cell lines rather than relying on transient expression
Rhodopsin has emerging potential as a biomarker for neurodegenerative diseases, making Recombinant Lithognathus mormyrus Rhodopsin valuable for comparative studies:
Research Applications:
Model System for Protein Misfolding:
Biomarker Development Pipeline:
Fish rhodopsins can provide comparative data for human biomarker development
Conservation of key structural features enables cross-species validation
Antibodies generated against conserved epitopes may have cross-reactivity
Experimental Approach:
Generate mutant versions that mimic disease-associated changes
Study protein stability and aggregation propensity in vitro
Develop rhodopsin quantification assays that can be translated to clinical samples
Recent research has established correlations between retinal thinning and several neurodegenerative disorders including Alzheimer's disease, Parkinson's disease, and Huntington's disease . Rhodopsin levels decrease prior to retinal thinning, suggesting its potential as an early biomarker for these conditions.
Accurate quantification of rhodopsin levels is essential for both basic research and biomarker development:
| Method | Detection Limit | Sample Type | Advantages | Limitations |
|---|---|---|---|---|
| ELISA | 5-10 ng/mL | Tissue/cell extracts | High throughput, specific | Requires validated antibodies |
| Western Blot | 50-100 ng/mL | Protein extracts | Size verification | Semi-quantitative, time-consuming |
| cSLO | In situ detection | Intact retina/tissue | Non-invasive, in vivo compatible | Specialized equipment required |
| Mass Spectrometry | 1-5 ng/mL | Purified/complex samples | Absolute quantification | Complex sample preparation |
| Spectrophotometry | 0.5-1 μM | Purified protein | Simple, direct | Requires purified protein |
Confocal scanning laser ophthalmoscopy (cSLO) represents a novel technique that allows for rhodopsin quantification in intact tissues, potentially enabling early detection of neurodegenerative processes . This approach measures rhodopsin concentration by detecting changes in autofluorescence following photobleaching.
For recombinant protein analysis, combining multiple methods provides comprehensive validation:
Initial quantification by spectrophotometry (A280 and A500 ratio)
Confirmation by SDS-PAGE with densitometry
Functional validation using G-protein activation assays
Structure-function analysis through targeted mutations provides valuable insights:
Critical Residues for Analysis:
Retinal Binding Pocket:
Mutations in the binding pocket (particularly lysine at position 296 based on homology) eliminate chromophore attachment
Hydrogen bonding network mutations alter spectral properties and activation kinetics
G-protein Interaction Interface:
Mutations in cytoplasmic loops alter signaling efficiency
Conservative substitutions can create constitutively active or inactive variants
Transmembrane Helices:
Mutations affecting helix packing alter thermal stability
Proline substitutions can lock the protein in specific conformational states
Experimental Design for Mutation Analysis:
Generate mutations using site-directed mutagenesis
Express mutant proteins alongside wild-type controls
Characterize using thermal stability assays, spectroscopic methods, and functional assays
Correlate findings with structural models
Mutation analysis is particularly valuable when comparing fish rhodopsin with human variants implicated in diseases like retinitis pigmentosa, potentially revealing conserved mechanisms of protein destabilization and aggregation .
Optogenetics utilizes light-sensitive proteins to control cellular activity, with rhodopsins being critical components:
Development Strategy:
Engineering Considerations:
Modify the protein sequence to alter wavelength sensitivity
Create fusion constructs with fluorescent reporters
Optimize membrane trafficking signals for neuronal expression
Vector Design:
Select appropriate promoters for target cell specificity
Include regulatory elements for controlled expression
Incorporate purification tags for biochemical characterization
Validation Protocol:
Test expression in neuronal cultures before in vivo applications
Measure light-induced currents using patch-clamp electrophysiology
Characterize spectral sensitivity and kinetics
Comparative Advantages:
Fish rhodopsins may offer spectral diversity beneficial for multiplexed optogenetics
Potential differences in photocycle kinetics provide unique temporal control options
Microbial rhodopsins including channelrhodopsin have been extensively used in neuroscience research for manipulating membrane potentials using light energy . The rapid kinetics and structural simplicity of opsins make them ideal candidates for neuronal expression in optogenetic applications.
Obtaining high-purity, functionally intact rhodopsin requires specialized purification approaches:
Purification Protocol:
Cell Lysis and Membrane Preparation:
Use detergent-free methods for initial cell disruption
Isolate membrane fractions through differential centrifugation
Perform all steps under dim red light to prevent photoactivation
Solubilization:
Select mild detergents (DDM, LMNG) at minimal effective concentrations
Include stabilizing agents (glycerol, cholesterol hemisuccinate)
Maintain temperature at 4°C throughout the process
Chromatography Sequence:
Affinity chromatography using antibodies or engineered tags
Size exclusion chromatography to remove aggregates
Optional: ion exchange chromatography for final polishing
Quality Control:
A280/A500 ratio assessment (ideally 1.6-1.8 for high purity)
Thermal stability measurements
SDS-PAGE and Western blot analysis
Functional assays (G-protein activation)
Maintaining protein stability during purification is critical, as retinal-bound rhodopsin is sensitive to light, temperature fluctuations, and detergent concentration. The rhodopsin must be kept in its stable dark state with 11-cis-retinal bound during the entire purification process to prevent conformation changes that lead to aggregation.
Evolutionary studies require careful experimental design:
Key Considerations:
Sequence Selection:
Include diverse species spanning evolutionary distances
Focus on conserved functional domains and variable regions
Use both closely related fish species and more distant vertebrates
Functional Equivalence Testing:
Express rhodopsins from multiple species under identical conditions
Compare spectral tuning properties across species
Measure G-protein coupling efficiency using consistent assays
Environmental Adaptation Analysis:
Correlate rhodopsin properties with species habitat (depth, water clarity)
Examine positive selection signatures in sequence data
Test thermal stability relative to species temperature ranges
Data Analysis Approach:
Apply phylogenetic correction for statistical comparisons
Use ancestral sequence reconstruction to identify key evolutionary transitions
Combine sequence, structural, and functional data in integrated analyses
Evolutionary comparisons can reveal how environmental pressures have shaped rhodopsin function, providing insights into molecular adaptation mechanisms that may be applicable to protein engineering for research or therapeutic applications.
The relationship between rhodopsin and retinal health offers diagnostic opportunities:
Diagnostic Development Pathway:
Biomarker Validation:
Establish normal ranges for rhodopsin levels in fish and mammalian models
Correlate rhodopsin quantification with retinal thinning progression
Identify disease-specific patterns of rhodopsin degradation
Assay Development:
Optimize antibodies against conserved epitopes for cross-species detection
Develop non-invasive imaging protocols based on cSLO technology
Create standardized protocols for sample collection and processing
Clinical Translation Strategy:
Validate in animal models of retinal degeneration
Correlate findings with human patient samples
Perform comparative studies against existing diagnostic methods
Recent research has revealed that rhodopsin levels decrease prior to observable retinal thinning, suggesting its potential as an earlier biomarker for diagnosis . The development of confocal scanning laser ophthalmoscopy (cSLO) for quantifying rhodopsin represents a promising non-invasive diagnostic approach that could detect changes before structural alterations become apparent.
Zinc plays a crucial role in rhodopsin stability and function:
Experimental Investigation Approach:
Binding Characterization:
Isothermal titration calorimetry to measure binding affinity
Mutagenesis of predicted zinc coordination sites
Spectroscopic analysis of zinc-dependent conformational changes
Functional Impact Assessment:
Measure thermal stability as a function of zinc concentration
Analyze the effect of zinc on chromophore binding kinetics
Investigate zinc influence on photobleaching and regeneration cycles
Disease-Relevant Models:
Create conditions mimicking zinc dysregulation seen in neurodegenerative diseases
Examine rhodopsin aggregation propensity under varying zinc conditions
Test protective compounds that may stabilize rhodopsin-zinc interactions
Research has shown that mutations affecting the high-affinity zinc-binding site in rhodopsin contribute to visual changes seen in conditions like retinitis pigmentosa and potentially Alzheimer's disease . A delicate balance of zinc is required, as both deficiency and excess can be detrimental – zinc deficiency contributes to retinal neurodegeneration, while excess promotes protein aggregation.